PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2806670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 216aa    MW: 24400.5 Da    PI: 8.2171
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2806670.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-32137195159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  Lj1g3v2806670.1 137 LDDGYRWRKYGQKAVKNSTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 195
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-32124195IPR003657WRKY domain
SuperFamilySSF1182903.14E-28131196IPR003657WRKY domain
PROSITE profilePS5081128.725132197IPR003657WRKY domain
SMARTSM007741.2E-37137196IPR003657WRKY domain
PfamPF031068.0E-26138195IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGDPMESQNP PPPPLLLLPP PQNNTFTTTT NPFLFNMSPQ DHNQGFSDID WGNLFCGQSS  60
SSLLLDGDYH ANKETTGIDP CGSSSDFLMM NESGGAQDYH HEGEKGGKEK RIKVGRVKKT  120
TKVPRFAFQT RSVDDILDDG YRWRKYGQKA VKNSTYPRSY YRCTHHTCNV KKQVQRLSKD  180
TSIVVTTYEG IHNHPCEKLM ETLTPLLKQI QFLASL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-24125194271WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2806670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0195921e-105EU019592.1 Glycine max WRKY64 (WRKY64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003624078.13e-95probable WRKY transcription factor 75
SwissprotQ9FFS33e-55WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLG7L6N96e-94G7L6N9_MEDTR; WRKY family transcription factor
STRINGAES802961e-94(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.18e-56WRKY DNA-binding protein 24