PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2611340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 810aa    MW: 88258 Da    PI: 6.216
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2611340.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.6e-21117172156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Lj1g3v2611340.1 117 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 172
                      688999***********************************************999 PP

2START206.97.7e-653255481206
                      HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                      ela++a++elvk+a+ +ep+Wv++   e++n de+ +++++  +     + +ea+r++g+v+ ++  lve+l+d++ +W+e+++    + +t+e
  Lj1g3v2611340.1 325 ELALAAMEELVKMAQTGEPLWVLEGgrEILNHDEYNRTVTPCIGlrpngFVSEASRETGMVIINSLALVETLMDSN-RWSEMFPcvvaRTSTTE 417
                      5899********************999*************9999********************************.***************** PP

                      EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
            START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                      vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++ ++ +  +++lpSg+++++++ng+skvtwveh
  Lj1g3v2611340.1 418 VISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSSgTPTFLNCRRLPSGCVVQDMPNGYSKVTWVEH 511
                      ************************************************************99******************************** PP

                      EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      ++++++++h+l+r+l++sg+ +ga++wva lqrqce+
  Lj1g3v2611340.1 512 AEYDESQVHQLYRPLLSSGIGFGAQRWVAILQRQCEC 548
                      ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20100174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-21104174IPR009057Homeodomain-like
PROSITE profilePS5007117.443114174IPR001356Homeobox domain
SMARTSM003892.2E-17115178IPR001356Homeobox domain
CDDcd000861.82E-18116174No hitNo description
PfamPF000461.9E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084844.647316551IPR002913START domain
SuperFamilySSF559612.06E-32318548No hitNo description
CDDcd088756.33E-121320547No hitNo description
SMARTSM002344.8E-46325548IPR002913START domain
PfamPF018522.8E-56325548IPR002913START domain
SuperFamilySSF559611.88E-22576803No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MSFGGVFENK QGGEGAKIVA DIAYNQDKMP SGAISQPRLA TPTLAKSMLN SSSLSLALQT  60
NIDGQGNGHG NGLIHENYEG HGLRRSREEE HESRSGSDNM DAASGDDFDA ADNRPRKKRY  120
HRHTPQQIQE LESLFKECPH PDEKQRLELS KRLCLETRQV KFWFQNRRTQ MKTQLERHEN  180
SLLRQENDKL RAENMSIREA MRNPMCSNCG GPAVMGEISL EEQHLRIENA RLKDELDRVC  240
ALAGKFLGRP IGPPLLNSSL ELGVGSNGFG GLSNMPSTLG PDFVGISSPL GMVTPPPPPA  300
QSTRTTTAMM SSGFDRSVER SMLLELALAA MEELVKMAQT GEPLWVLEGG REILNHDEYN  360
RTVTPCIGLR PNGFVSEASR ETGMVIINSL ALVETLMDSN RWSEMFPCVV ARTSTTEVIS  420
NGINGTRNGA LQLMHAELQV LSPLVPVREV NFLRFCKQHA EGVWAVVDVS IDTIRETSSG  480
TPTFLNCRRL PSGCVVQDMP NGYSKVTWVE HAEYDESQVH QLYRPLLSSG IGFGAQRWVA  540
ILQRQCECLA ILMSSALPSR EHAAISAGGR RSMLKLAQRM TNNFCAGVCA STVHQWNKLN  600
NTSNNNAGAE EVRVMTRKSV DDPGEPPGIV LSAATSVWLP VAPQRVFDFL RDERLRSEWD  660
ILSNGGPMQE MAHIAKGQDH ANCVSLLRAS AMNANQSSML ILQETCTDAS GSLVVYAPVD  720
IPAMHVVMNG GDSAYVALLP SGFSVVPDGN GQGGGDDRGS ASGGSLLTVA FQILVNSLPT  780
AKLTVESVET VNNLILCTVQ KIKAALNGES
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.101062e-37pod
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2611340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027349905.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0S3RT530.0A0A0S3RT53_PHAAN; Uncharacterized protein
TrEMBLA0A4D6NHU60.0A0A4D6NHU6_VIGUN; Homeobox-leucine zipper protein
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]