PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2327880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Trihelix
Protein Properties Length: 292aa    MW: 34734.7 Da    PI: 7.4505
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2327880.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.89.2e-2654136186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk ++++e +    s++++p++++l+
  Lj1g3v2327880.1  54 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNQMKEKGYHRSAEQCKCKWKNLVTRYKGCETMEPEA---SRQQFPFYNDLQ 136
                      7********************************************************************95...56679*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122037.89E-2253118No hitNo description
PfamPF138379.5E-2154138No hitNo description
PROSITE profilePS500907.29455111IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGHQLHHQH HRRNQHQNLN QHQHQQQQQQ QQQHAHNIIA SASVSADVTD RFPQWSIQET  60
KEFLVIRAEL DQTFMETKRN KQLWEVISNQ MKEKGYHRSA EQCKCKWKNL VTRYKGCETM  120
EPEASRQQFP FYNDLQAIFT VRMQRMLWAE AEGGSKKKGV HLSSEDDDDG NEESEGDHNK  180
AGNSRKKKKS KVAGGGSGGG SSNLKEILEE FMRQQMQMEA QWMEAYEARE SERRLREMEW  240
RQAMEALENE RVMMDQRWRE REEQRRIREE ARAENRDALI TALLNKLRRE DM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-79AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140273.11e-132hypothetical protein PHAVU_008G098300g
SwissprotO804502e-72TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLV7B3011e-132V7B301_PHAVU; Uncharacterized protein
STRINGGLYMA03G07590.21e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-55Trihelix family protein