PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2069900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 336aa    MW: 36763.8 Da    PI: 5.7554
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2069900.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.3e-18226260135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Lj1g3v2069900.1 226 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 260
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-8014316IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.215220256IPR000679Zinc finger, GATA-type
SMARTSM004018.2E-18220270IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-14221257IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577169.98E-16223284No hitNo description
CDDcd002026.98E-15225272No hitNo description
PfamPF003201.2E-15226260IPR000679Zinc finger, GATA-type
PROSITE patternPS003440226251IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MEAHEEFFSP QFPSDTTTTT NINNATAAAA DQFIVEDLFD FSNDDATFDD SLPANSTEGS  60
PPPLDSTTTT TTTTTNSNFL HDISPRNSAD GNFSGDLSVP YDELAELEWL SKFAEESFSS  120
EDLQKMQLIS GMKVPNDAAS QTHDEPTGPL FSPPVSVPAK ARSKRSRGPP CNWTSRLLVL  180
SPSTTPTSSS ASDSDTTAAP ALVPTAVKKP SALRKRDADV GDGRRCLHCA TDKTPQWRTG  240
PMGPKTLCNA CGVRYKSGRL VPEYRPAASP TFMLTKHSNS HRKVLELRRQ KEMMKAQQQQ  300
LLQMQHHQSM MFDASSNGDD YLIHQHVAGP DFSHLI
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v2069900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027356291.11e-142GATA transcription factor 9
SwissprotO826323e-91GATA9_ARATH; GATA transcription factor 9
TrEMBLA0A371FCD01e-139A0A371FCD0_MUCPR; GATA transcription factor 9 (Fragment)
STRINGXP_007137230.11e-136(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.18e-78GATA transcription factor 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]