PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1853300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 406aa    MW: 45465.5 Da    PI: 6.6379
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1853300.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.3e-083543872154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp++e++++L +++gL+ +q+ +WF N+R +
  Lj1g3v1853300.1 354 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 387
                      469*****************************87 PP

2ELK30.11.1e-10308329122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+L+++Y+++++++++E++
  Lj1g3v1853300.1 308 ELKHELKHGYKSKIVDIREEIM 329
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-20140184IPR005540KNOX1
PfamPF037904.8E-18142183IPR005540KNOX1
SMARTSM012561.3E-27196251IPR005541KNOX2
PfamPF037918.7E-20200250IPR005541KNOX2
PfamPF037894.5E-6308329IPR005539ELK domain
PROSITE profilePS512139.673308328IPR005539ELK domain
SMARTSM011883.8E-4308329IPR005539ELK domain
PROSITE profilePS5007111.888328391IPR001356Homeobox domain
SMARTSM003895.7E-11330395IPR001356Homeobox domain
SuperFamilySSF466893.81E-16330393IPR009057Homeodomain-like
CDDcd000863.07E-12331392No hitNo description
Gene3DG3DSA:1.10.10.602.9E-25335393IPR009057Homeodomain-like
PfamPF059201.1E-17348387IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAYNHHHHLS QDLPIHHFSD QQQQDHHNHH PLLDDPTTKP NSSDPHQTAP NWLNNALLRP  60
HYTTTTTTTT NANTNFLNLQ TANSDSSAAQ SSSQWLARPV LHGKVIDGGA DMSHDSTGGE  120
KTEPVTEGGA DGGLMSWQNA KCKAEILSHP LYEQLLSAHV ACLRIATPVD QLPRIDAQLA  180
QSQNVVAKYS AFGHGSQGML GEDKELDHFL SHYVLLLCSF KEQLQQHVRV HAMEAVMACW  240
EIEQSLQSLT GVSPGEGTGA TMSDDEDDQV DSDANLFDGG LDGHDNMGFG PLVPTENERS  300
LMERVRQELK HELKHGYKSK IVDIREEIMR KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE  360
EDKARLVQET GLQLKQINNW FINQRKRNWH SNASTSTALK SKRKRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1384404RKRNWHSNASTSTALKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.148290.0pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136985.10.0hypothetical protein PHAVU_009G090500g
SwissprotO041360.0KNAP3_MALDO; Homeobox protein knotted-1-like 3
TrEMBLV7ATS50.0V7ATS5_PHAVU; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-177KNOTTED1-like homeobox gene 3