PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1782140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32664 Da    PI: 8.7441
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1782140.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-18135189256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tk+q   Le+ F+++++++ ++++eLA+kl+L +rqV vWFqNrRa+ k
  Lj1g3v1782140.1 135 RKKLRLTKQQSLLLEDIFKQHSTLNLKQKQELARKLNLRTRQVEVWFQNRRARTK 189
                      78889************************************************98 PP

2HD-ZIP_I/II1101.6e-35135226192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rl+k+q+ lLE+ F+++++L+ ++K+elar+L+l++rqv+vWFqnrRARtk+kq+E+++e Lk+++++l+een+rL+ke +e+++ +k
  Lj1g3v1782140.1 135 RKKLRLTKQQSLLLEDIFKQHSTLNLKQKQELARKLNLRTRQVEVWFQNRRARTKLKQTESNCELLKKCCETLTEENKRLQKELQEIKSMMK 226
                      69*************************************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-17130192IPR009057Homeodomain-like
PROSITE profilePS5007117.151131191IPR001356Homeobox domain
SMARTSM003891.7E-15133195IPR001356Homeobox domain
CDDcd000861.56E-14134192No hitNo description
PfamPF000467.2E-16135189IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-17140189IPR009057Homeodomain-like
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
SMARTSM003409.5E-15191238IPR003106Leucine zipper, homeobox-associated
PfamPF021832.8E-7191225IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MVGFDNSIPG LRLGLGLGHC MMKTDHEHRK KKKEDQDPCN KLAYPSLKLG LPDHDDVDLT  60
TNNNDQLILA TKTESEDWFH HPHTSNSPSA VSSLISNSCS IKRERDQFSG DEELELDVEN  120
THSKAVDVEE NGSPRKKLRL TKQQSLLLED IFKQHSTLNL KQKQELARKL NLRTRQVEVW  180
FQNRRARTKL KQTESNCELL KKCCETLTEE NKRLQKELQE IKSMMKSTKP DQTLYMQLPL  240
TSLTICSSCK RIRSGESNNG SASSSTTTTA FTISPKRSII TSIGASYS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12833RKKKKE
2183191RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v1782140.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027356145.12e-91homeobox-leucine zipper protein HAT9-like
SwissprotA2XE764e-54HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL44e-54HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A371EXA11e-83A0A371EXA1_MUCPR; Homeobox-leucine zipper protein HOX19 (Fragment)
STRINGXP_007136800.14e-76(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-55HD-ZIP family protein