PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1341630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 188aa    MW: 21406.2 Da    PI: 5.0431
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1341630.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.72.3e-3291271128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGf F+Ptdeelv ++L+ k++  +++  ++i+e++   ++Pw+L+ k+ ++ +++yfFsk +         nr+t+ gyWk+ g ++++ls
  Lj1g3v1341630.1   9 LPPGFLFSPTDEELVLHFLHCKASFLPCHP-NIIPELHHSLLDPWELNGKAFSSGNQYYFFSKVN--------GNRSTEIGYWKEIGVTEPILS 93 
                      79*************************999.89**************966667789999999864........489999*************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +e+vg+kk Lvfy g+ p+g++t+W+m+ey++
  Lj1g3v1341630.1  94 AVDEKVGIKKYLVFYIGEPPQGTETSWMMQEYHI 127
                      *9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-406161IPR003441NAC domain
PROSITE profilePS5100537.8539161IPR003441NAC domain
PfamPF023658.8E-2010127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MADGISINLP PGFLFSPTDE ELVLHFLHCK ASFLPCHPNI IPELHHSLLD PWELNGKAFS  60
SGNQYYFFSK VNGNRSTEIG YWKEIGVTEP ILSAVDEKVG IKKYLVFYIG EPPQGTETSW  120
MMQEYHICSS GLDSSPYPSA WGRRKPDMNW SKWVLCRVYE KKRSKQCVNC SCSDDDDSGS  180
ELSWLDEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-33616614170NO APICAL MERISTEM PROTEIN
1ut4_B3e-33616614170NO APICAL MERISTEM PROTEIN
1ut7_A3e-33616614170NO APICAL MERISTEM PROTEIN
1ut7_B3e-33616614170NO APICAL MERISTEM PROTEIN
3swm_A2e-33616617173NAC domain-containing protein 19
3swm_B2e-33616617173NAC domain-containing protein 19
3swm_C2e-33616617173NAC domain-containing protein 19
3swm_D2e-33616617173NAC domain-containing protein 19
3swp_A2e-33616617173NAC domain-containing protein 19
3swp_B2e-33616617173NAC domain-containing protein 19
3swp_C2e-33616617173NAC domain-containing protein 19
3swp_D2e-33616617173NAC domain-containing protein 19
4dul_A3e-33616614170NAC domain-containing protein 19
4dul_B3e-33616614170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v1341630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027361480.11e-100NAC domain-containing protein 104-like
SwissprotQ8GWK62e-51NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A151ST195e-95A0A151ST19_CAJCA; NAC domain-containing protein 68
STRINGGLYMA04G38990.14e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-48xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]