PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1304790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 344aa    MW: 38503 Da    PI: 4.4789
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1304790.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.91.5e-4761331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l pGfrFhPtd el++++Lk+k+ g+k+++ +vi+e+diyk+ PwdLp k  +k+++ +wyfF++r  ky+tg + nrat+ gyWk+tgkd++v
  Lj1g3v1304790.1   6 LIPGFRFHPTDVELIMYFLKRKILGRKFPF-DVIAELDIYKYAPWDLPdKsVLKTGDLKWYFFCPRGMKYSTGGKLNRATEFGYWKTTGKDRSV 98 
                      579***************************.99**************96446677888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + k+++vg+ +tLvf+ grapkg +tdWvmhe+r+
  Lj1g3v1304790.1  99 EH-KNQVVGMIRTLVFHIGRAPKGDRTDWVMHEFRI 133
                      *9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-584156IPR003441NAC domain
PROSITE profilePS5100553.6256156IPR003441NAC domain
PfamPF023653.4E-248133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MADTKLIPGF RFHPTDVELI MYFLKRKILG RKFPFDVIAE LDIYKYAPWD LPDKSVLKTG  60
DLKWYFFCPR GMKYSTGGKL NRATEFGYWK TTGKDRSVEH KNQVVGMIRT LVFHIGRAPK  120
GDRTDWVMHE FRIEHKDLAD KGIPQDSYVI CRVFQKEGPG PRNGAQYGKP FNEEDWDEDE  180
EIDSKQSMPV ATTSAPGPVL PTASLVAVTN DMHTSPSVCM GLTSELCLSG SVPSCSTHPS  240
APNNQVDEFK EYDNTLSVND YNGNEKVDHP DLANNAEGGP YQDPNEIFGE LGDLDSLLGL  300
GEADLRGDPF SRGQEDECTT NEMLSTSSWF CGDGDFLELI DLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-45115712166NO APICAL MERISTEM PROTEIN
1ut4_B2e-45115712166NO APICAL MERISTEM PROTEIN
1ut7_A2e-45115712166NO APICAL MERISTEM PROTEIN
1ut7_B2e-45115712166NO APICAL MERISTEM PROTEIN
3swm_A3e-45115715169NAC domain-containing protein 19
3swm_B3e-45115715169NAC domain-containing protein 19
3swm_C3e-45115715169NAC domain-containing protein 19
3swm_D3e-45115715169NAC domain-containing protein 19
3swp_A3e-45115715169NAC domain-containing protein 19
3swp_B3e-45115715169NAC domain-containing protein 19
3swp_C3e-45115715169NAC domain-containing protein 19
3swp_D3e-45115715169NAC domain-containing protein 19
4dul_A2e-45115712166NAC domain-containing protein 19
4dul_B2e-45115712166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v1304790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502931.11e-178NAC domain-containing protein 82 isoform X1
SwissprotQ9FY823e-87NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A1S2YE671e-177A0A1S2YE67_CICAR; NAC domain-containing protein 82 isoform X1
STRINGXP_004502931.11e-178(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.13e-86NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]