PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1049410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GRF
Protein Properties Length: 504aa    MW: 54668.2 Da    PI: 8.2543
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1049410.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81.1e-24139182144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Lj1g3v1049410.1 139 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 182
                      79***************************************998 PP

2QLQ47.55.5e-1785115232
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                      +FT +Q+ +L +Q+++yKy++a++PvP++Ll
  Lj1g3v1049410.1  85 PFTSSQWRELQRQAMIYKYMMASVPVPSDLL 115
                      8****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-784120IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-1185115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.24385120IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739139183IPR014977WRC domain
PfamPF088791.7E-20140182IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MGEEPFSNNK MTMMLLHQHQ NHHHRPFSSP FDSVHGGCGP TFSSSCVLSP APIEGAVIRP  60
PLQQPFETPT FKSPGCGGMA TLGFPFTSSQ WRELQRQAMI YKYMMASVPV PSDLLISTTS  120
LMPTTLDGGF NLRLSNGTDP EPGRCRRTDG KKWRCSRDVA PNHKYCERHM HRGRPRSRKP  180
VEVHTNNTMN NNSSLPIKRA RHDCNPFSSA GDVTVAVSNR KNGSQSHFLA NSQPYIEKSS  240
FSLDNFGLKA ANFGSLASVS SNREPRGLEW MLNGDPISLG ASDSGWHSLM HDKKVGGSCN  300
NTEPQYLNSF ALYSSGLDHH DRSLPPFLNP LVVPMEHLQS EKPRGFIDAW SNTETREINA  360
NKNSTSSIGK LTLSSLDLSM GGAVHDEMGT IGMGLGLMEH DGNTREDTKI SLSNWLNPSP  420
WVASSTPGGP LAEVLRPSTI TSDAATSGPS SPAVTHVESS RTMVSSPSGV LQKALASFSD  480
SSSNSSPTIA SSRASSEITL LKFN
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj1g3v1049410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-52AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027334397.10.0growth-regulating factor 7 isoform X1
TrEMBLA0A0L9UDP80.0A0A0L9UDP8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3REI00.0A0A0S3REI0_PHAAN; Uncharacterized protein
STRINGXP_007136458.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-39growth-regulating factor 2