PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0360389.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 618aa    MW: 68344.6 Da    PI: 6.9534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0360389.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.5e-21124179156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Lj0g3v0360389.1 124 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 179
                      688999***********************************************999 PP

2START200.38e-633215451206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++el+k+a+ +ep+W++ +    e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d + +W e+++    + +t
  Lj0g3v0360389.1 321 ELALAAMDELMKMAQTGEPLWMRNVevgrEILNHEEYMRTFTPCIGirpngFVSEASRETGMVIINSLALVETLMDAN-RWAEMFPcmiaRTAT 413
                      5899**************************************99989*******************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                       ev+ssg      galqlm  el +lsplvp R++ f+R+++q+++g+w++vd S+d  ++ +  +s+  +++lpSg+++++++ng+skvtwve
  Lj0g3v0360389.1 414 NEVVSSGingtrnGALQLMHGELHVLSPLVPvREVNFLRFCKQHREGVWAVVDLSIDTIREGSGVPSFGNCRRLPSGCVVQDMPNGYSKVTWVE 507
                      **************************************************************99****************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      h++++++++h+l+r+l++sg+ +ga++w atlqrqce+
  Lj0g3v0360389.1 508 HAEYDESQVHQLYRPLLSSGMGFGAQRWIATLQRQCEC 545
                      ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-21104181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-22109181IPR009057Homeodomain-like
PROSITE profilePS5007117.362121181IPR001356Homeobox domain
SMARTSM003894.7E-17122185IPR001356Homeobox domain
PfamPF000461.5E-18124179IPR001356Homeobox domain
CDDcd000861.15E-17124181No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PROSITE profilePS5084842.319312548IPR002913START domain
SuperFamilySSF559612.61E-31314545No hitNo description
CDDcd088752.25E-125316544No hitNo description
SMARTSM002341.7E-45321545IPR002913START domain
PfamPF018521.1E-54321545IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MSFGGFLDSN NSGGGGGGGR NIAADVPYSN GNTTNDRMAF GAISQPRLVT TTPSLAKPMF  60
TSPGLSLALQ QSNIDGQEDV NRMCEPNGLK RSREEEQSRS GSDNMDGGAS CDEQDAADNP  120
PNKKKRYHRH TPQQIQELEA LFKECPHPDE KQRLELSRRL CLETRQVKFW FQNRRTQMKT  180
QLERHENTLL RQENDKLRGE NMSIRDAMRN PICSNCGGPA MIGEISIEEQ HLRIENARLK  240
DELDRVCALA GKFLGRPISS LPNSSLELGV GGNNGFGGMN TMPDFGMANS LAMVSPSIRP  300
SPTGVTSGFV DRSIERSMIV ELALAAMDEL MKMAQTGEPL WMRNVEVGRE ILNHEEYMRT  360
FTPCIGIRPN GFVSEASRET GMVIINSLAL VETLMDANRW AEMFPCMIAR TATNEVVSSG  420
INGTRNGALQ LMHGELHVLS PLVPVREVNF LRFCKQHREG VWAVVDLSID TIREGSGVPS  480
FGNCRRLPSG CVVQDMPNGY SKVTWVEHAE YDESQVHQLY RPLLSSGMGF GAQRWIATLQ  540
RQCECLAILM SSAPPSIRDH SAPITAGGKR SMLKLAQRMT NNFCAGVCAS TVHKWNKLNP  600
GNVEENVRVM TRQSIDDP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.101060.0pod
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0360389.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027334620.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3VDP60.0A0A1S3VDP6_VIGRR; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]