PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0357379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 330aa    MW: 36448 Da    PI: 6.7006
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0357379.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.6e-33162220159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+s++prsYYrCt a+C vkk+vers++dp+vv++tYeg+H h+
  Lj0g3v0357379.1 162 LDDGYRWRKYGQKAVKNSPYPRSYYRCTAASCGVKKRVERSSHDPSVVVTTYEGQHIHP 220
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.5E-34147222IPR003657WRKY domain
SuperFamilySSF1182901.09E-28154222IPR003657WRKY domain
PROSITE profilePS5081132.42157222IPR003657WRKY domain
SMARTSM007745.8E-38162221IPR003657WRKY domain
PfamPF031063.7E-26163220IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MSTTTTSSFL FQPSPVSTIF DHPMPSSCHQ KDSSSFMDLL AFNDDYNNSV LDWLPITGDP  60
VNLNHPLPSP SSEVLNTPAS PNNSCSISSS SNEGSAKVQQ STEPKTELEE EDNNGNGDGG  120
RGDDPAEQDK TKKQLKTKKK KNVKKEREAR FAFMTKSEVD QLDDGYRWRK YGQKAVKNSP  180
YPRSYYRCTA ASCGVKKRVE RSSHDPSVVV TTYEGQHIHP CPTTTRSTLA SFMHNNEPSF  240
GFANVSASQY SSQHSFALPH ASSTSATMLY NSSTTPLSTT SSFGGFVHQD HAGNHYHQQE  300
AMLRDNGLLQ DIILPSNIMS NIQDNKDSFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-29152222777Probable WRKY transcription factor 4
2lex_A3e-29152222777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.98870.0cell culture| pod| protoplast| root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0357379.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1345150.0BT134515.1 Lotus japonicus clone JCVI-FLLj-11J23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025981424.11e-75probable WRKY transcription factor 48 isoform X2
SwissprotO229003e-49WRK23_ARATH; WRKY transcription factor 23
TrEMBLI3S2181e-129I3S218_LOTJA; Uncharacterized protein
STRINGGLYMA15G14860.21e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.15e-46WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]