PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0348179.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 223aa    MW: 25449 Da    PI: 6.0699
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0348179.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.71.3e-35101091100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC+++C+lapyfpa+qpk f n hklFG+sn++k+l+++++ ++ +am+sl+ +A+ r + Pv+G+++ i++++ q+ q+++el
  Lj0g3v0348179.1  10 ACAACKHQRRKCTPECPLAPYFPADQPKLFMNCHKLFGVSNIVKILNQVEPCQKGIAMDSLIAQANYREKYPVHGCCEAINRVRYQIWQMEEEL 103
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                       ll+++
  Lj0g3v0348179.1 104 LLLRHH 109
                      999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5569110IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3410106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MTLKGGVTLA CAACKHQRRK CTPECPLAPY FPADQPKLFM NCHKLFGVSN IVKILNQVEP  60
CQKGIAMDSL IAQANYREKY PVHGCCEAIN RVRYQIWQME EELLLLRHHL EMCQQQHHQQ  120
SILEDVTSPL ELGMTPCANS LQQQSYSNSN CVAYNNSCIM DSKDINVTNP LWANDHNSNS  180
MSGQKQLVTT QLLSIQEEVV ENYDEMNPFF DTIDDRQSYI CSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-2661037104LOB family transfactor Ramosa2.1
5ly0_B6e-2661037104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0348179.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225931.11e-91LOB domain-containing protein 27
SwissprotQ9STS62e-44LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A151SMQ23e-90A0A151SMQ2_CAJCA; LOB domain-containing protein 27
STRINGXP_004508794.13e-84(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-38LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]