PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0321769.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family SBP
Protein Properties Length: 1023aa    MW: 113349 Da    PI: 8.1042
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0321769.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.6e-40103180178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C +dl++ak+yhrrhkvCe+hska+++lv  ++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Lj0g3v0321769.1 103 MCQVDNCGEDLTRAKDYHRRHKVCEAHSKASKALVGVQMQRFCQQCSRFHPLPEFDEGKRSCRRRLAGHNRRRRKTQP 180
                      6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-3398165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.658101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-37102182IPR004333Transcription factor, SBP-box
PfamPF031102.8E-29104177IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.36E-5771920IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1023 aa     Download sequence    Send to blast
MEKVAPPLPP MAAVHGLFYD PASTAASKKR DLSYDVGRVT ENWNPKEWNW DSVRFMAKPS  60
GTVTSRGGGG GGEDGEGLGL KLNLGGANKR VRSGSPGTAS YPMCQVDNCG EDLTRAKDYH  120
RRHKVCEAHS KASKALVGVQ MQRFCQQCSR FHPLPEFDEG KRSCRRRLAG HNRRRRKTQP  180
EDVASTTVAT ASPAAANLEI FNLLTAAITG GSQGKFEERR SQVPDKEQLV QILNRIPLPA  240
DLTAKLLDVG NVNAKSDQVP MQTSPSYSHH DNQLNHTPSA PLTKDLLGVL STTLSTPSPS  300
AVSLHSQNGS LSSNVSGDKS RTSADHTRGQ QFTGVGGERS SGSSQSPVED SDSQEDVRVN  360
LPLQLFSSSP EDESLPKKAS SRKYFSSDSS NPMEERSPTS SPPIVEMQFG LRGGDRVLKP  420
ESISSARGGN ANKEANRIYG CDISLDLFKG SNNRIQQPSS LRSVPFQAGY TSSSSDHSPP  480
SLNSDAQDRT GRIMFKLFDK HPSHFPRTLR PQIYNWLSNR PSDLESYIRP GCVVLSIYAT  540
MSSSAWEQLE ENFLQHVHSL IQNSDSDFWR GGRFLVHCGS QLASHKDGKI RLCKPWRTWR  600
SPELISASPL AIVSGQETTI SLKGRNLSTP GTKVHCTGTG CYTTAEVTVS AYPGMAYEEI  660
KLDGFKVQNA IPGILGRCFI EVENGFKGNS FPLIIADSTI CKELKPLESE FYEEKTCDAI  720
SEEHEYHFGR PRSREEALHF LNELGWLFQR QQFLNVHEGP DYSLNRFKYL LTFSVERNCC  780
MLVKTLLDIL VKEHTEGEWL STRSMEMLNA IQLLNRAVKR KYTGMIDLLI HYSVPCKNDT  840
SRMYVFPPNL EGPGGITPLH LAACTSSSEG LIDSLTNDPQ EIGLKCWESL ADANGQTPHA  900
YAMMRNNHSY NELVARKLAD RQRGEISLRI DTAIEQQSFR VELVQKQSNQ LQRGENSCAK  960
CAIAETHYNR RISGSKGWLH RPFIHSILAV AAVCVCVCVF FRGTPFVGSE GPFRWENLDY  1020
GTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3194177184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.221900.0protoplast
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0321769.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237510.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A371G3J20.0A0A371G3J2_MUCPR; Squamosa promoter-binding-like protein 14 (Fragment)
STRINGXP_004498230.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]