PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0292769.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Trihelix
Protein Properties Length: 272aa    MW: 32602.9 Da    PI: 7.241
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0292769.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.32.4e-2434116186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +W+  e+++ + +r e+++++ ++k++k+lW+ +s +m+e+g++rs+ qCk+kw+nl +ryk ++++e++     ++++p++++l+
  Lj0g3v0292769.1  34 QWSIAETKEFLVMRAELDQAFMETKRNKQLWDVISTNMKEKGYHRSADQCKCKWKNLVTRYKGCETMEQEA---GRQQFPFYNELQ 116
                      7********************************************************************84...5568******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.29E-213398No hitNo description
PfamPF138375.3E-2034117No hitNo description
PROSITE profilePS500906.9223591IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEGHHHLHLQ QQQQHLLPHQ NIITNVDVTD RFPQWSIAET KEFLVMRAEL DQAFMETKRN  60
KQLWDVISTN MKEKGYHRSA DQCKCKWKNL VTRYKGCETM EQEAGRQQFP FYNELQATFN  120
ARMQRMMWAE AEAAGSKKKA VELSSDDEDD VNEESAEADH QKAGNRRKKK KAKVACGSGG  180
LNNLKEILEE FMRQQMQIEA QWMEAFESRE NERRLKEMEW RQQMEVLKNQ RIMMDQRWRE  240
REEQRRIREE ARAEKRDALI TALLNKLERE EM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1235114786DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165170RRKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004506754.11e-126PREDICTED: trihelix transcription factor GT-3b
SwissprotO804503e-69TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0B2SBM41e-123A0A0B2SBM4_GLYSO; Trihelix transcription factor GT-3b
TrEMBLK7KD371e-123K7KD37_SOYBN; Uncharacterized protein
STRINGGLYMA03G07590.21e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.15e-50Trihelix family protein