PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0291669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GeBP
Protein Properties Length: 215aa    MW: 24176.6 Da    PI: 9.6752
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0291669.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57393.42.4e-2915106293
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                       f++lw +eDei++L+Gl df +ktg +p + +dafy+fv ks+++++++ ql +K rrLKkKf+k+  k k+g++p+f k+hdqk+fel++
  Lj0g3v0291669.1  15 PFRKLWCDEDEITILKGLPDFISKTGNDPLKYVDAFYDFVIKSLQVDANHAQLKDKARRLKKKFEKHACKGKNGESPKFPKAHDQKAFELAN 106
                      6899**************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.7E-2616107IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEEDGKMPDN DSKKPFRKLW CDEDEITILK GLPDFISKTG NDPLKYVDAF YDFVIKSLQV  60
DANHAQLKDK ARRLKKKFEK HACKGKNGES PKFPKAHDQK AFELANKKEA NSSSKNVASS  120
AKKAKAEARQ EPPPPESDMQ DVKADDTSVL LSEMSGLNED VVKKGLELIG ASKRAQLAGR  180
WKKIQVAELE LFAKRAQLVE EQTRLILEAY KSSKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.20941e-76cell culture| floral bud| flower| pod| protoplast| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0291669.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541767.16e-60STOREKEEPER protein
RefseqXP_027329839.13e-60probable transcription factor At1g11510
RefseqXP_027329849.13e-60probable transcription factor At1g11510
RefseqXP_027329858.13e-60probable transcription factor At1g11510
RefseqXP_028188775.16e-60STOREKEEPER protein-like
TrEMBLA0A445I9S71e-58A0A445I9S7_GLYSO; Putative transcription factor isoform A
TrEMBLK7M1T51e-58K7M1T5_SOYBN; Uncharacterized protein
STRINGGLYMA13G32440.22e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.15e-20DNA-binding storekeeper protein-related transcriptional regulator