PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0287339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 175aa    MW: 19534.1 Da    PI: 6.6531
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0287339.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.26.7e-4461051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+++C++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+sslv+eA+ar+rdPvyG+vg i+ lq q++ql+ +l
  Lj0g3v0287339.1   6 PCASCKLLRRRCTQECIFAPYFPSDDPRKFAIVHKVFGASNISKMLQELPVHQRADAVSSLVFEANARVRDPVYGCVGAISYLQDQVSQLQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Lj0g3v0287339.1 100 AVAQTE 105
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.375106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCTQE CIFAPYFPSD DPRKFAIVHK VFGASNISKM LQELPVHQRA  60
DAVSSLVFEA NARVRDPVYG CVGAISYLQD QVSQLQMQLA VAQTEILCIQ MQQDPAASLP  120
VHQVDHQDVK SLLLSDHNNY QILPQQYLSF PSSSSSSSSV FQDSYDSLKR ESFWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-53AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537315.23e-94PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151QRV16e-95A0A151QRV1_CAJCA; LOB domain-containing protein 12
STRINGGLYMA11G29450.15e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-75LBD family protein