PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0273489.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 246aa    MW: 27476.8 Da    PI: 8.3838
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0273489.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18176210135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  Lj0g3v0273489.2 176 CLHCGAEKTPQWRAGPHGPKTLCNACGVRFKSGRL 210
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.387170206IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-16170220IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-15172234No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14174208IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.37E-14175223No hitNo description
PfamPF003201.1E-16176210IPR000679Zinc finger, GATA-type
PROSITE patternPS003440176201IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVMGALGSVD DLLNFSSDIG EEDDDDEKPN KAFPSLNPIC SDPPSFNPSD LNGRSHSVPA  60
YAEEELEWLS NKDAFPAIET FVELSSIHPD LAKHQKAAPK IDYSTSSSNS NNSSNSITLL  120
SGYDHLKVPV RARSRRRSRR RPIIADNSGQ QFWWQQLSNE ICKEEAIKIS TIGRKCLHCG  180
AEKTPQWRAG PHGPKTLCNA CGVRFKSGRL VPEYRPASSP TFRTELHSNS HRKVMEMRKQ  240
KHMGMG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130140RARSRRRSRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0273489.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027363961.11e-119GATA transcription factor 1
RefseqXP_027363962.11e-119GATA transcription factor 1
TrEMBLA0A1S2Y2H61e-114A0A1S2Y2H6_CICAR; GATA transcription factor 1
STRINGGLYMA10G25480.11e-112(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.13e-41GATA transcription factor 1