PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0272799.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 176aa    MW: 19167.5 Da    PI: 4.3277
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0272799.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY65.77.3e-21142176135
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---E CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvk 35 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+
  Lj0g3v0272799.3 142 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCMVR 176
                      59******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-23127176IPR003657WRKY domain
SuperFamilySSF1182908.89E-19134176IPR003657WRKY domain
PROSITE profilePS5081124.398137176IPR003657WRKY domain
SMARTSM007743.1E-10142176IPR003657WRKY domain
PfamPF031062.6E-15143176IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MQVDNPEHVE PQRVGEGDLG WADAQKGNIA GAGNWKQDNL EVTSSASVGP EYGNQSTNLQ  60
TQNGTNLDSG EAVDGSSTFS NEEEEDDQGT HGSVSLGYDG EGDESESKRR KLESYATELS  120
GATRAIREPR VVVQTTSEVD ILDDGYRWRK YGQKVVKGNP NPRSYYKCTN AGCMVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-22133176851Probable WRKY transcription factor 4
2lex_A1e-22133176851Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0272799.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004499679.11e-111probable WRKY transcription factor 2 isoform X2
RefseqXP_012571036.11e-111probable WRKY transcription factor 2 isoform X1
SwissprotQ9FG771e-54WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A1S2Y5I81e-109A0A1S2Y5I8_CICAR; probable WRKY transcription factor 2 isoform X2
TrEMBLA0A1S3E7Q71e-109A0A1S3E7Q7_CICAR; probable WRKY transcription factor 2 isoform X1
STRINGXP_004499679.11e-110(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.15e-57WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]