PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0272799.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 490aa    MW: 53033.1 Da    PI: 4.7244
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0272799.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.54.9e-32293350260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgs++prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g Hnh+k
  Lj0g3v0272799.2 293 EDGYNWRKYGQKQVKGSDYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGAHNHPK 350
                      7****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-28289351IPR003657WRKY domain
SuperFamilySSF1182909.29E-26291351IPR003657WRKY domain
SMARTSM007746.1E-35292350IPR003657WRKY domain
PfamPF031069.8E-25293349IPR003657WRKY domain
PROSITE profilePS5081123.043293351IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MAGIDDNVAL TGDWGLHSPS PRTLFSRMLE EDNVTRSISE HPGSGRTGDL FPGTHDSSET  60
GRANMRESSQ DGNSGVQLTD PSFQTEQKSN SNSRGGLVER MAARAGFNAP RLNTESIRST  120
DLSLNSDIRS PYLTIPPGLS PTTLLDSPVF LANSLAQPSP TTGKFLFTSN GNIRCSELSS  180
DAPEKRKDNG FDDFYASSFA FKPTTDSGSS FYHDAGRKTN QTTLPQQSLP GIEASVQSRP  240
SFQSQSVDAV KVQTENKSGL EHSAPLEEQA DEEGDQRVNV DTVAAGVGGA PSEDGYNWRK  300
YGQKQVKGSD YPRSYYKCTH PNCQVKKKVE RSHEGHITEI IYKGAHNHPK PPPNRRSSGL  360
GSVNPHTDMQ VDNPEHVEPQ RVGEGDLGWA DAQKGNIAGA GNWKQDNLEV TSSASVGPEY  420
GNQSTNLQTQ NGTNLDSGEA VDGSSTFSNE EEEDDQGTHG SVSLGYDGEG DESESKRRYL  480
YYSASSFFES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-172943521675WRKY transcription factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0272799.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027333911.10.0probable WRKY transcription factor 2
SwissprotQ9FG771e-106WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A445KGX30.0A0A445KGX3_GLYSO; Putative WRKY transcription factor 2
TrEMBLA0A4D6M2I70.0A0A4D6M2I7_VIGUN; WRKY transcription factor 33
STRINGGLYMA06G47880.30.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-108WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]