PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0268639.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 333aa    MW: 38400 Da    PI: 6.4593
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0268639.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-072803122254
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       +yp++e++++L +++gL+ +q+ +WF N+R +
  Lj0g3v0268639.2 280 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 312
                      69*****************************87 PP

2ELK29.22.1e-10233254122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+L+++Y+++++++++E++
  Lj0g3v0268639.2 233 ELKHELKQGYKEKIVDIREEIL 254
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-1567111IPR005540KNOX1
PfamPF037902.5E-1669110IPR005540KNOX1
SMARTSM012566.1E-26120176IPR005541KNOX2
PfamPF037919.8E-19125175IPR005541KNOX2
PfamPF037897.3E-7233254IPR005539ELK domain
SMARTSM011886.1E-4233254IPR005539ELK domain
PROSITE profilePS512139.969233253IPR005539ELK domain
PROSITE profilePS5007111.564253316IPR001356Homeobox domain
SMARTSM003891.8E-10255320IPR001356Homeobox domain
SuperFamilySSF466898.13E-16255318IPR009057Homeodomain-like
CDDcd000863.00E-10256317No hitNo description
Gene3DG3DSA:1.10.10.606.1E-25260317IPR009057Homeodomain-like
PfamPF059203.6E-18273312IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAFHDHHLQH EIAFQRFAEE QELSENRDMP PPQPTWLNAQ QRQQNFMHLQ PETSTAEKSG  60
GGGEDLREYK ADILGHQLYE QLLSAHVSCL RIATPVDQLP RIDAQLQQSQ RVLEKYSALG  120
SNHRVVDEKE LDQFMTHYVL LLCAFKEQLQ QHVRVHAMEA VMACWDLEQS LQSLTGVSPG  180
EGTGATMSDD EDDQAESNAN LYESSMDGAD SLGFGPLVPT ESERSLMERV RHELKHELKQ  240
GYKEKIVDIR EEILRKRRAG KLPGDTTSLL KAWWQAHSKW PYPTEEDKAR LVQETGLQLK  300
QINNWFINQR KRNWHTNPSS ATSTKTKRKR RNQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1309330RKRNWHTNPSSATSTKTKRKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.30450.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1386280.0BT138628.1 Medicago truncatula clone JCVI-FLMt-17B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155117.10.0hypothetical protein PHAVU_003G174900g
SwissprotP480001e-162KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLV7CDZ80.0V7CDZ8_PHAVU; Uncharacterized protein
STRINGGLYMA17G11330.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-164KNOTTED1-like homeobox gene 3