PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0266959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 266aa    MW: 30603.4 Da    PI: 8.8298
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0266959.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1880132456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      + +++ eq+++Le+ Fe  +++ ae++ +LAk lgL+ rq+ +WFqNrRa++k
  Lj0g3v0266959.1  80 KKRLNLEQVKALEKSFELGNKLEAERKVQLAKALGLKPRQIAIWFQNRRARWK 132
                      4568889*********************************************9 PP

2HD-ZIP_I/II115.72.7e-3778170193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekk+rl+ eqvk+LE+sFe  +kLe erKv+la++Lgl+prq+a+WFqnrRAR+ktk+lEk++ +Lk+ +da k++n++L+ ++++L +el++
  Lj0g3v0266959.1  78 EKKKRLNLEQVKALEKSFELGNKLEAERKVQLAKALGLKPRQIAIWFQNRRARWKTKHLEKEFVVLKKPFDAAKADNDELKLQNQKLYTELQA 170
                      69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1872135IPR009057Homeodomain-like
PROSITE profilePS5007116.98974134IPR001356Homeobox domain
SMARTSM003892.1E-1777138IPR001356Homeobox domain
CDDcd000865.34E-1579135No hitNo description
Gene3DG3DSA:1.10.10.603.9E-1879132IPR009057Homeodomain-like
PfamPF000462.0E-1580132IPR001356Homeobox domain
PRINTSPR000311.0E-5105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5114130IPR000047Helix-turn-helix motif
PfamPF021833.5E-8134173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDFPSSHPFM FNTTEDHDHH LPSISLNNFS SLPPQHFQGG APFLLKRSMS FSGTENKCNK  60
VHGDQDELSD DGLYQSGEKK KRLNLEQVKA LEKSFELGNK LEAERKVQLA KALGLKPRQI  120
AIWFQNRRAR WKTKHLEKEF VVLKKPFDAA KADNDELKLQ NQKLYTELQA LKRRDWCEAR  180
TISFKKETEG TWSNGSENSS DINLDLSRTS ISNSPVSPQN NKNLMTTSIK TPSITQLLQF  240
SSRPNLQDEG LCNMFHNIDE HQNFWP
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0266959.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027359248.11e-132homeobox-leucine zipper protein ATHB-20-like
TrEMBLA0A371FLA01e-136A0A371FLA0_MUCPR; Homeobox-leucine zipper protein HAT7 (Fragment)
STRINGGLYMA09G37410.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.11e-68homeobox protein 20