PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0251169.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 738aa    MW: 80983.1 Da    PI: 6.4208
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0251169.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-2150105156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++k +++t++q++eLe++F+ +++p++++r +L+k lgL+ +qVk+WFqNrR+++k
  Lj0g3v0251169.1  50 KKKYHRHTPQQIHELETFFKGCPHPDEKQRSDLSKTLGLENKQVKFWFQNRRTQMK 105
                      79999************************************************999 PP

2START168.15.9e-532614662206
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT... CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg... 88 
                      la++a++el+k+a+ ++p+W kss    e +n++e+ ++      +++  ++  g v++v+  + ++ + ++  +  ++++a t+++iss+   
  Lj0g3v0251169.1 261 LALAAMDELIKMAQIDSPLWIKSSsggqEVLNQEEYAKIC-----SPYTGSKPAGYVTEVSR-ETRDRWLQM--FPSMITRAVTMDAISSDtag 346
                      7899********************8887778888888888.....67999999****99999.888888888..888888************** PP

                      .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHH CS
            START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwl 180
                       galqlm aelq++splvp R   f+R+++q+++g+wv+vdvSvd  ++  +s +++ +++lpSg++++++++g sk+twv+h  ++++++h++
  Lj0g3v0251169.1 347 tGALQLMHAELQLPSPLVPvRQLNFLRFCKQHREGVWVVVDVSVDFGRNAANSNPFMNCRRLPSGCVVQDTPEGMSKITWVDHSQYDENVIHQM 440
                      **************************************************99****************************************** PP

                      HHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 181 lrslvksglaegaktwvatlqrqcek 206
                      +r+lv+sg+ +ga +wvatlqrqce+
  Lj0g3v0251169.1 441 YRPLVNSGIGFGAHRWVATLQRQCEC 466
                      ************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2136107IPR009057Homeodomain-like
SuperFamilySSF466891.34E-1937107IPR009057Homeodomain-like
PROSITE profilePS5007117.47547107IPR001356Homeobox domain
SMARTSM003891.7E-1849111IPR001356Homeobox domain
PfamPF000464.0E-1950105IPR001356Homeobox domain
CDDcd000862.79E-1654107No hitNo description
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PROSITE profilePS5084837.958251469IPR002913START domain
CDDcd088751.66E-82256465No hitNo description
SuperFamilySSF559611.41E-25256466No hitNo description
SMARTSM002341.8E-29260466IPR002913START domain
PfamPF018524.0E-45261466IPR002913START domain
SuperFamilySSF559612.44E-16490719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MGLIGENFDS GLMGGARDDE YESRSGSDNF DVASGDDQDA GDDQPPQKKK KKYHRHTPQQ  60
IHELETFFKG CPHPDEKQRS DLSKTLGLEN KQVKFWFQNR RTQMKTQLER QENMILKQEN  120
EKLRAENNMM QEAISNPSCN NCGGPAILGQ ISLEGHQIRI ENARLKDELN RTGALVSKFL  180
GRPLSSLGSP MALSTPNFGL EIGFGKNGVA DSSNFSMSLP AGLDMGDGVF GAPPATLSGT  240
RSPMGMMGNE AQVEGSTLTH LALAAMDELI KMAQIDSPLW IKSSSGGQEV LNQEEYAKIC  300
SPYTGSKPAG YVTEVSRETR DRWLQMFPSM ITRAVTMDAI SSDTAGTGAL QLMHAELQLP  360
SPLVPVRQLN FLRFCKQHRE GVWVVVDVSV DFGRNAANSN PFMNCRRLPS GCVVQDTPEG  420
MSKITWVDHS QYDENVIHQM YRPLVNSGIG FGAHRWVATL QRQCECLAML MSPSIPSEVS  480
PDGRRSMLRL AQRMTNSFWS GVCPSSASKW EILHIGNNNT RFMSRKHVDY SGEATSIVLS  540
AATSVWLPVS RQRVFDFLRD GQNRGKWDIF SSGVTNQEMH HVIKGQGQGN CVSVLGASNN  600
AANGNDRKLW LQDSWTDTSG SMIVYSSIDV QSFNIVASGQ DSAYISLFPS GFSILPDGHS  660
NNNCVGTSTN GSNGGAGNTN AGGCLLTFGI QMQNNLPTTM LTVESVDTIN RHLSSTIQKI  720
KMHTELGMNE AFFDSSEI
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0251169.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0098561e-104AP009856.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT45D13, TM1761a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515730.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186734.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186735.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186736.10.0homeobox-leucine zipper protein ROC6-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S2Z6360.0A0A1S2Z636_CICAR; homeobox-leucine zipper protein ROC6-like isoform X1
STRINGXP_004515730.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]