PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0251039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 245aa    MW: 27088.6 Da    PI: 6.7931
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0251039.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-331569155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     k+rlrWt+eLH rFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Lj0g3v0251039.1 15 KQRLRWTHELHGRFVDAVAQLGGPDRATPKGVLRVMGVEGLTIYHVKSHLQKYRL 69
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.0731272IPR017930Myb domain
SuperFamilySSF466891.67E-171469IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-321470IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-251570IPR006447Myb domain, plants
PfamPF002492.3E-81768IPR001005SANT/Myb domain
PfamPF143796.3E-23101147IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDPVNEPNNP NFASKQRLRW THELHGRFVD AVAQLGGPDR ATPKGVLRVM GVEGLTIYHV  60
KSHLQKYRLA KYIHDSSLDG EIADKKETTD MLSNQDGSSG MQITEALKLQ MEVQKRLHEQ  120
LEVQRQLQLR IEAQGNYLKK IIEEQQRLSG VLSERLDSGI SPLVPGDMCQ KDGNKTDPTT  180
PAPSSECPLL EKAAKERAPA ESLSIGESFS SHHEPRTPDS CCHGGSSVSS PEGEMSAKKQ  240
RVSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-231572158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-231572158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-231572158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-231572158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-231572259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.209160.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0251039.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027331247.11e-139myb family transcription factor PHL7-like isoform X2
SwissprotQ9SJW01e-105PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA5C9661e-130A5C966_VITVI; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF86103343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-91G2-like family protein