PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0224429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GATA
Protein Properties Length: 528aa    MW: 58159.3 Da    PI: 6.9076
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0224429.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA504.2e-16741135
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                     C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Lj0g3v0224429.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                     ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-9153IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-11546No hitNo description
CDDcd002029.28E-16651No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003206.9E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF139196.9E-7293370IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHS RADNVDNDDQ  60
RVSRLKNMSL NKNKEVKFVK RKLNHDNAAS GGFTPDYYQG FQKFVDEDTS NRSSSGSAIS  120
NSESCAQFGG MDASDLTGPA QSVVWDTVVP SKKRTCAGRP KHSSVEKLTK DLCSILHEQQ  180
SYFSATSEEE LLFESETPMV SVEIGHGSIL IRHPNSIARE EESEASSLSV DNKQCLMSEA  240
YSYSGTIPMH SDSSGMNFSS QGVEKVRKSA GHTIQLEQLE RGKSQLEKLD VPGNHVSSLC  300
SIDLNDVVNY EVFSRNLTNE EKQQLLKYLP VVDTAKLPDS LKIMFDSFQF KENFSYFQQL  360
LGEGVFDISL VGAKPEACKT LKRLALSNLS KSKWVECYNS LKKGGNQAGK CIDLGSTAMA  420
SSNVANVKRL RYSQNQNFPE LKTMRSPKRV TIKASCEGKE VAEEGSNCSP RSLFALPGDG  480
SLCMLDSLNF VAESSDQDLL LEVPSNSSFP QAELLHPTSS SWCPCQHQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.43600.0pod
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0224429.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524128.10.0GATA transcription factor 26
RefseqXP_028231829.10.0GATA transcription factor 26-like
SwissprotQ8W4H11e-148GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A445KK780.0A0A445KK78_GLYSO; GATA transcription factor 26
TrEMBLI1K0V30.0I1K0V3_SOYBN; Uncharacterized protein
STRINGGLYMA05G05320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-141GATA transcription factor 26