PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0224079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 283aa    MW: 31323 Da    PI: 8.4523
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0224079.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-3299155258
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+vers+edp++++itYeg H h
  Lj0g3v0224079.1  99 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCSAKKQVERSNEDPETLIITYEGLHLH 155
                      8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.39393158IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.2E-3096155IPR003657WRKY domain
SuperFamilySSF1182908.63E-2796155IPR003657WRKY domain
SMARTSM007748.7E-3698157IPR003657WRKY domain
PfamPF031062.2E-2699155IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MANWSPILDD DGSPFLMQPE PNNTIIRAVS RDQAFNYRFI SNIYSGPTIS DIENALSVTT  60
NKTEHFSASA RVSILERNLS KIENKYTLKI KCFGNGMGDD GYKWRKYGQK SIKNSPNPRS  120
YYRCTNPRCS AKKQVERSNE DPETLIITYE GLHLHFAYPC FLVGQPQQSQ SHPPVKKSKF  180
TSSQVQAQAQ AQDFIVNEAQ ASASVGLTSP TLLNSPQDMA QQNLGSQGLL EDMVPFMVRN  240
PSNNLNSGYS KLSCSADPSP TSPPLWTSGH STSFHTVGLN STT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-21991591575WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.77650.0root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0224079.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061030.0AP006103.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT11J24, TM0185, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028240309.11e-139probable WRKY transcription factor 49 isoform X2
SwissprotQ9FHR71e-47WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLA0A371FUZ61e-138A0A371FUZ6_MUCPR; Putative WRKY transcription factor 49 (Fragment)
TrEMBLA0A445JWC01e-138A0A445JWC0_GLYSO; Putative WRKY transcription factor 49
STRINGGLYMA07G16040.21e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.14e-48WRKY DNA-binding protein 49