PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0223589.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 371aa    MW: 41015.3 Da    PI: 4.6997
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0223589.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.41.8e-34163217155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Lj0g3v0223589.2 163 KPRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVEGLTIYHVKSHLQKYRT 217
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.495160220IPR017930Myb domain
SuperFamilySSF466895.55E-18161217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-32161219IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-25163217IPR006447Myb domain, plants
PfamPF002496.5E-10165216IPR001005SANT/Myb domain
PfamPF143792.0E-19252296IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSSSFPVFRS SSAQAASINS NVRGAGHMFS APAEFPDDIP FSAVSELHSS SAFVAHPGDV  60
SWGPDPFQDI LQFSDDVSIQ NDLMEYSAPY VSGDNAKAAD IGEWVEQLMS ADEPPHPTWN  120
QILGDDNVTE PSSKEAQVSQ QQHVPSREAN DLPNSASNAP QTKPRMRWTP ELHEAFVEAV  180
NQLGGSEKAT PKGVLNLMKV EGLTIYHVKS HLQKYRTARY KPESSEDTGT PEHKLTSIEE  240
MKSLDLKTSK GITEALRLQM ELQKRLHEQL EDQRKLQIQI ENQGKRLQMM FEKQIKSDEP  300
SASLSKAVLP SPADNLETSN EGHEKAGISS STPENLPEES SQDRGDAKVT DEHELVDDQF  360
STPPTKRVKT L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-31163221260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.135780.0cell culture| pod| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0223589.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1476090.0BT147609.1 Lotus japonicus clone JCVI-FLLj-17K16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027189768.11e-176protein PHR1-LIKE 1
SwissprotQ8GUN54e-81PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A3Q7XQN81e-175A0A3Q7XQN8_CICAR; protein PHR1-LIKE 1
STRINGXP_004495581.11e-175(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.31e-83G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]