PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0223189.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 358aa    MW: 40385.1 Da    PI: 7.7369
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0223189.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.4e-50171431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      + pGfrF Ptdeel+++yL+kk++g++ ++ +vi+ev+i+k+ePwdLp +++ ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+
  Lj0g3v0223189.2  17 MFPGFRFCPTDEELISYYLRKKLDGHEESV-QVISEVEICKYEPWDLPaMSFIQSDNEWFFFSPRGRKYPNGSQSKRATECGYWKATGKERNVK 109
                      579************************988.99***************656667899************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Lj0g3v0223189.2 110 S-GSNVIGTKRTLVFHLGRAPKGERTEWIMHEYCI 143
                      *.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-566158IPR003441NAC domain
PROSITE profilePS5100553.91317159IPR003441NAC domain
PfamPF023654.5E-2619142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELVSREVPL SMATPSMFPG FRFCPTDEEL ISYYLRKKLD GHEESVQVIS EVEICKYEPW  60
DLPAMSFIQS DNEWFFFSPR GRKYPNGSQS KRATECGYWK ATGKERNVKS GSNVIGTKRT  120
LVFHLGRAPK GERTEWIMHE YCINDKSQDS LVVCRLKRNT EFRLSDASNR ASSSQIQPVH  180
SHESSDGGID QSQRGLGEGA QDKEVGCSSK RSSSSYGSEQ IESVSESNQR PANDGHLTES  240
SGHLKEVDEE DCYAEILKND IIKLDESSIS KAGHTIPEDP AQLDNYQGTA QRRIRLRVKR  300
PRRSAEGARC SSKMHSSKSS FFARITTRLV VVFAFLVFTL VGVCFWSSFG TWSRTSEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-441615816164NO APICAL MERISTEM PROTEIN
1ut4_B3e-441615816164NO APICAL MERISTEM PROTEIN
1ut7_A3e-441615816164NO APICAL MERISTEM PROTEIN
1ut7_B3e-441615816164NO APICAL MERISTEM PROTEIN
3swm_A3e-441615819167NAC domain-containing protein 19
3swm_B3e-441615819167NAC domain-containing protein 19
3swm_C3e-441615819167NAC domain-containing protein 19
3swm_D3e-441615819167NAC domain-containing protein 19
3swp_A3e-441615819167NAC domain-containing protein 19
3swp_B3e-441615819167NAC domain-containing protein 19
3swp_C3e-441615819167NAC domain-containing protein 19
3swp_D3e-441615819167NAC domain-containing protein 19
4dul_A3e-441615816164NAC domain-containing protein 19
4dul_B3e-441615816164NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.181530.0cell culture
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates in imbibed seeds (PubMed:19704545). Detected in early stages of seed development, especially in the basal tip of immature embryo. Particularly expressed in vascular tissues of inflorescence stems, roots, leaves and petioles (PubMed:17410378). {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:19704545}.
UniprotTISSUE SPECIFICITY: Expressed in seeds, leaves, roots and inflorescence (PubMed:17410378). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0223189.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1422790.0BT142279.1 Lotus japonicus clone JCVI-FLLj-14J15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631443.10.0NAC domain-containing protein 40
SwissprotQ9XIN78e-92NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A072VB300.0A0A072VB30_MEDTR; NAC transcription factor-like protein
TrEMBLG7IHH00.0G7IHH0_MEDTR; NAC transcription factor-like protein
STRINGAES671080.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.12e-84NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]