PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0205169.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family GeBP
Protein Properties Length: 306aa    MW: 32622.5 Da    PI: 4.8799
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0205169.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57381.41.3e-25188270183
           DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfske 83 
                      k+f rlws+eDei++L+Gl df +ktg +p +  dafy+fv +s++++++++q+ +K+rrLKkKf++   k k+g+ p+f k 
  Lj0g3v0205169.1 188 KQFTRLWSDEDEIAILKGLADFISKTGNDPLKYPDAFYDFVIRSLQADATRTQVKDKVRRLKKKFQTLAGKGKNGETPKFPKV 270
                      5799***************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.8E-22190269IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAQKQKRPSP LEDPPTASSS SESEEEDDQP LSQVKHAAAE EEELSSEEEG SSEEEEEDET  60
TAPAPPAATT SHTKPPQPEP ESDSATQSDS ESDTDSDQAP SASAPTPNPK VKPLATKPMD  120
QTQTHKPKAQ PSPAPAKSAA KRAAESNANA GDSKRAKKKA VDSAPAAAAG SDEEMEEDGK  180
KSGNDSKKQF TRLWSDEDEI AILKGLADFI SKTGNDPLKY PDAFYDFVIR SLQADATRTQ  240
VKDKVRRLKK KFQTLAGKGK NGETPKFPKV QRVGGGGANE AAAAEEKPKA NGKPAKSPCK  300
ESERRS
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0205169.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027329839.12e-70probable transcription factor At1g11510
RefseqXP_027329849.12e-70probable transcription factor At1g11510
RefseqXP_027329858.12e-70probable transcription factor At1g11510
TrEMBLA0A151S0W41e-57A0A151S0W4_CAJCA; Uncharacterized protein
STRINGGLYMA13G32440.22e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.17e-16DNA-binding storekeeper protein-related transcriptional regulator