PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0183889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 299aa    MW: 34169.5 Da    PI: 4.7406
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0183889.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.4e-092422762155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      + +yp++ee+ +L++ +gL+ +q+ +WF N+R ++
  Lj0g3v0183889.1 242 RWPYPTEEEKLQLSEMTGLDIKQINNWFINQRKRH 276
                      469*****************************885 PP

2ELK37.36e-13196217122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK++LlrKY+gyL+sL++EF+
  Lj0g3v0183889.1 196 ELKEMLLRKYGGYLSSLRKEFL 217
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.1E-205498IPR005540KNOX1
PfamPF037907.8E-205697IPR005540KNOX1
SMARTSM012562.0E-20103154IPR005541KNOX2
PfamPF037914.9E-21106153IPR005541KNOX2
SMARTSM011885.0E-7196217IPR005539ELK domain
PfamPF037894.5E-10196217IPR005539ELK domain
PROSITE profilePS5121311.366196216IPR005539ELK domain
PROSITE profilePS5007112.6216279IPR001356Homeobox domain
SuperFamilySSF466899.84E-20218288IPR009057Homeodomain-like
SMARTSM003891.0E-12218283IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27221281IPR009057Homeodomain-like
CDDcd000865.73E-12228280No hitNo description
PfamPF059203.4E-17236275IPR008422Homeobox KN domain
PROSITE patternPS000270254277IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEDIYRMNPF LSSPQDHVVA TAGSSQLHLG LVASNYLQME EPEPGLTGSE MSDRLIKSQI  60
ASHPLYPNLV SAYIECQKVG APTELASFLE EIARENHNSS NGFGREIGDD PELDEFMESY  120
CEVLQRYQQE LFKPFNEATL FLCDIESQLS ELCKGTLTMP SDNNRSDEAA GTSEDELSCG  180
KVEAVEYSGM RQGDQELKEM LLRKYGGYLS SLRKEFLKKR KKGKLPKDAR KTLTDWWNTH  240
YRWPYPTEEE KLQLSEMTGL DIKQINNWFI NQRKRHWKPS EDMRFAIMEG VSGGIIGPM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211220LRKEFLKKRK
2217221KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.178780.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1443360.0BT144336.1 Lotus japonicus clone JCVI-FLLj-11L21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605816.11e-155PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_006605817.11e-155PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP292e-94KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLI3SV380.0I3SV38_LOTJA; Uncharacterized protein
STRINGGLYMA20G22986.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.11e-79KNOTTED-like from Arabidopsis thaliana 2