PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0169309.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family Nin-like
Protein Properties Length: 305aa    MW: 35183.8 Da    PI: 5.0829
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0169309.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.83e-25141190352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +s  +ls yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ sl
  Lj0g3v0169309.1 141 RMLSRTTLSLYFYMPITEAARELNVGLTLLKKRCRELGIRRWPHRKLMSL 190
                      5689999****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7127211IPR003035RWP-RK domain
PfamPF020422.3E-20143190IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MIMGVHPFTS WSSNSDMSDE NLYPLTCQFS HSGNGSASYP ALDWSDEFPI YDSHFDAAPY  60
NVECYPVDPL YETLSIEPTP LTVQDYDFYE VKEGFSVWNE IDAGFESEKA LLYCTNEESG  120
KELMGNVKAK RGREVRSSST RMLSRTTLSL YFYMPITEAA RELNVGLTLL KKRCRELGIR  180
RWPHRKLMSL QTLIKNVQEL GKEGNEGEEK LRNAIEILEK EKKLVEEMPD KDLESNTKRL  240
RQACFKANYK KRRLMEMEKM DPKYSSFYSG PVSVSITSSY ATSECCYDDE KEHDIKGDLR  300
SKLPF
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0169309.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0103270.0AP010327.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjB21L22, BM1890, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020225154.11e-115protein RKD2
TrEMBLA0A445KIH01e-115A0A445KIH0_GLYSO; Protein RKD1
STRINGXP_007155308.11e-101(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-36RWP-RK domain-containing protein