PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0155359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 371aa    MW: 41822 Da    PI: 7.6525
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0155359.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.34.8e-56161421129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
  Lj0g3v0155359.1  16 LPPGFRFHPTDEELISHYLYKKVIDIEFSA-RAIGEVDLNKCEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFR 108
                      79**************************99.89***************888999**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +++lvg+kktLvfykgrapkgek++Wvmheyrle
  Lj0g3v0155359.1 109 -GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 142
                      .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6512166IPR003441NAC domain
PROSITE profilePS5100559.67516166IPR003441NAC domain
PfamPF023653.5E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MENISVLSKE EDQMDLPPGF RFHPTDEELI SHYLYKKVID IEFSARAIGE VDLNKCEPWD  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIFRGK SLVGMKKTLV  120
FYKGRAPKGE KSNWVMHEYR LEGKFSVHNL PKTAKNEWVI CRVFQKSSAG KKTHISGIMR  180
LDSLGLGHHE LGSSLPPLTD SLSSINKTKA LLDSAYVPCF SNQIDVQRNH QGGIYDSFSN  240
SIYGVSSNPL EFFPRVPPSS GSLYSTTQGV QVPSSLPFPG SVYSMQDQAI LRALYENNAS  300
NFVNGFKAER DMVSVSQETD LTTDMNAETS SVVSNFEMGR RSFENQNQNQ NQNPPPASAA  360
GVDHDHGLWS Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-551317217174NAC domain-containing protein 19
3swm_B1e-551317217174NAC domain-containing protein 19
3swm_C1e-551317217174NAC domain-containing protein 19
3swm_D1e-551317217174NAC domain-containing protein 19
3swp_A1e-551317217174NAC domain-containing protein 19
3swp_B1e-551317217174NAC domain-containing protein 19
3swp_C1e-551317217174NAC domain-containing protein 19
3swp_D1e-551317217174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0155359.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027331675.10.0NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-143NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A072URG40.0A0A072URG4_MEDTR; NAC transcription factor-like protein
STRINGGLYMA17G10970.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-135NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]