PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0129219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 243aa    MW: 27186.1 Da    PI: 8.0282
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0129219.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-31117172156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+ Fv+a++qLGG+++AtPk+i+e m+v gLt+++vkSHLQkYRl+
  Lj0g3v0129219.1 117 KQRRCWSPELHRLFVDALQQLGGPQVATPKQIREQMQVGGLTNDEVKSHLQKYRLH 172
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.319114174IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-28115176IPR009057Homeodomain-like
SuperFamilySSF466896.57E-18115175IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-26117172IPR006447Myb domain, plants
PfamPF002491.8E-8119170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MKTNSRGNGS FTILKETIDM KNWMSSAQLW SAETKSRSGE DHRFVPHNPI QPWIETSNSE  60
GAFAAFNGNS CVTKTALRDD KEISKVPSLG LMAQAFELHH GNSTSQGQQQ QRQNPRKQRR  120
CWSPELHRLF VDALQQLGGP QVATPKQIRE QMQVGGLTND EVKSHLQKYR LHFRRISTSE  180
DQCGDNNKFS KGNLSQSGSP QGPLYLGGSV NVLSNSVDTE EDDEQSDCHS WKGGIHQQPQ  240
LLV
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0129219.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027917691.11e-101transcription factor HHO5-like isoform X1
TrEMBLA0A0L9TG552e-98A0A0L9TG55_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4E72e-98A0A0S3R4E7_PHAAN; Uncharacterized protein
STRINGXP_007155959.12e-93(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-33G2-like family protein