PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0127839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 305aa    MW: 34305.8 Da    PI: 9.9336
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0127839.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.44.9e-31118171255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH++Fv+ v+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lj0g3v0127839.1 118 PRMRWTTTLHAHFVHTVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 171
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.96E-15115172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-27116172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-22118171IPR006447Myb domain, plants
PfamPF002493.9E-6119170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MYTTTQNTVM PLIFLPEPDL SLNISPPFIN SDFEAKEMGG YNGLTLSTSS GSDLSQDNGF  60
FHSEPKLSLG IENVDLMNPH QVVQGLSRKF NHFYQPHIHG CNFKRSTRSG VKRSVRAPRM  120
RWTTTLHAHF VHTVQLLGGH ERATPKSVLE LMNVKDLTLA HVKSHLQMYR TVKSTDKGTG  180
HGQKDMGLNQ KTGMAICEKI SARDRAYNLN QRTSWQSPSI ESNTNNYRQK PENSLMHSHL  240
KGNQTTVGEH KYGVLSNCMK EGLDASSLSR SEVKLIDLEF TLGLRPLIKQ NTRNHQESSL  300
FSSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16119173357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16119173357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16119173357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16119173357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16119173458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During ovule development, first expressed in the inner integument primordium and then on the abaxial side of the inner integument. {ECO:0000269|PubMed:16623911}.
UniprotTISSUE SPECIFICITY: Expressed in the periphery of the primary root apex and lateral root. {ECO:0000269|PubMed:15286295}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0127839.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027356962.11e-106probable transcription factor KAN4
SwissprotQ9FJV56e-47KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A445K4951e-99A0A445K495_GLYSO; Putative transcription factor KAN4
TrEMBLK7KSW91e-99K7KSW9_SOYBN; Uncharacterized protein
STRINGGLYMA06G03901.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-49G2-like family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]