PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0109229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 375aa    MW: 41292.9 Da    PI: 8.1659
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0109229.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.2e-28208263156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W++eLH+rF++a++qLGG+++AtPk+i+e++kv+gLt  +vkS LQk+Rl+
  Lj0g3v0109229.1 208 KQRRCWSQELHKRFLHALQQLGGPDVATPKQIREHLKVDGLTTVEVKSYLQKFRLH 263
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24205266IPR009057Homeodomain-like
PROSITE profilePS5129413.616205265IPR017930Myb domain
SuperFamilySSF466893.85E-16206266IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-23208263IPR006447Myb domain, plants
PfamPF002492.8E-7210260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MLFSQKMQPH KMGSREYIQA LEEERKKIQV FPRELPLSLE LVTQAIEACR QQLSGTTTDY  60
NLNNGQSECS GQTSTEDGPV FEEFFPMKKR AAPDCDEKDE DDDDDELHSH KKKSDWLRSV  120
QLWNPNPSTT KEDLPRKTNV VEVKRNGGAF HPFHREESGV GKASNVVSAA CKAPSSPPVP  180
ATSSTGPVRV DSNDGGSKRD EKGQAQRKQR RCWSQELHKR FLHALQQLGG PDVATPKQIR  240
EHLKVDGLTT VEVKSYLQKF RLHTRRSPVI HNNANSQTTP LFLVGNIYVQ PSEYGAVATT  300
TTGSGELTKV TAPSGIYAPV AAHPPATAVM KSPQLKQLEV SSNSEERTNH SEGAVHSNSA  360
ASSSSTHSTT TSPRC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.108870.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0109229.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3533020.0AB353302.1 Lotus japonicus MYB mRNA for MYB-type transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027360963.11e-179transcription factor HHO3-like
TrEMBLD2KTV30.0D2KTV3_LOTJA; MYB-type transcription factor
STRINGXP_007153350.11e-170(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.13e-71G2-like family protein