PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0103139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 266aa    MW: 29854.9 Da    PI: 8.2072
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0103139.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-19134188256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Lj0g3v0103139.1 134 RKKLRLTKEQSAMLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 188
                      788899***********************************************98 PP

2HD-ZIP_I/II125.82e-40134224192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rl+keq+++LEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+++Lk+++++l++en rL+ke +eL+ +lk
  Lj0g3v0103139.1 134 RKKLRLTKEQSAMLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCDFLKKCCETLTDENMRLQKELQELK-ALK 224
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.13E-18128191IPR009057Homeodomain-like
PROSITE profilePS5007117.556130190IPR001356Homeobox domain
SMARTSM003896.3E-16132194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-18134188IPR009057Homeodomain-like
CDDcd000865.41E-17134191No hitNo description
PfamPF000461.5E-16134188IPR001356Homeobox domain
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
SMARTSM003404.3E-21190232IPR003106Leucine zipper, homeobox-associated
PfamPF021834.4E-10190224IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGLDQDAKNP SLQLILGLAL TLTPEDQTTN RSPSNKVVAD HEPNPTQPRK LYPEAEPSLT  60
LGLSGESYPQ KVVKVNKNKV FYGEDGLDLS TTQTSPHCST VSSFSSGKVK RERDHGSEEV  120
DTAEIDEDGA TAARKKLRLT KEQSAMLEES FKQHSTLNPK QKQALARQLN LRPRQVEVWF  180
QNRRARTKLK QTEVDCDFLK KCCETLTDEN MRLQKELQEL KALKTQPLYM PMPAATLTMC  240
PSCERLCSMA SKPHFFNPFT NPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.20470.0root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0103139.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1339410.0BT133941.1 Lotus japonicus clone JCVI-FLLj-11J7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027346594.11e-125homeobox-leucine zipper protein HAT22 isoform X1
SwissprotP466046e-85HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLI3S0E40.0I3S0E4_LOTJA; Uncharacterized protein
STRINGGLYMA11G04840.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-73HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]