PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0089499.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family G2-like
Protein Properties Length: 467aa    MW: 50933.4 Da    PI: 8.7146
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0089499.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32280333255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lj0g3v0089499.2 280 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 333
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15277333IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28278333IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23280333IPR006447Myb domain, plants
PfamPF002498.7E-7281332IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MPLEGIFIEP PTSTSTPPDL SLQISPPSTS SSLICTTSTA ATDYEGRHNP PSTTNFNFPS  60
RTVPQAHTEL SLGRNFSGEP PHQYNYNNPY YQNQQQQQLL ARTGAATTTS NSTTHHINHI  120
NYGVSLLDVS SSDGGLRPIK GIPVYHNRSF PFLPVEHSRD KDHHHPKMYL YHHLPNSYPP  180
SNSPSSLPSP PSSSSPSPYF AGALDPISSL SSGASAAAAA AYRAATTTRL NGISGAEPFK  240
SHPLHHYNGV GLGSSHETSP GLMRSRFMPK LPTKRSMRAP RMRWTSTLHA RFVHAVELLG  300
GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDRP AVSSGLSDGS GEDDMSPVAS  360
SGGPRQFSDQ RGLQDRPLQQ DMDYSSTTTT LWSNSSSREP WPQTSSNEVE GFRPTIFQSQ  420
PISGGHQIQK CDSTQLKNNL SGSNLECKNP SLEFTLGRPD WNGKGQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16281335357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16281335357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16281335357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16281335357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16281335458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.38291e-101pod
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0089499.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-42AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027336348.10.0transcription repressor KAN1-like
TrEMBLA0A371G8D20.0A0A371G8D2_MUCPR; Transcription repressor KAN1 (Fragment)
STRINGXP_007163357.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-56G2-like family protein