PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0086419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 542aa    MW: 60147.2 Da    PI: 5.7158
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0086419.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-094614991854
                      HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +F++  ++yp+++e+  LA k gLt +qV++WF N R +
  Lj0g3v0086419.1 461 MFQNflHPYPKEAEKHLLAVKSGLTRSQVSNWFINARVR 499
                      5887779******************************88 PP

2BELL68.71.1e-22334402372
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      q+ ++ k++Ll ll+ Vd+rY+q+ ++++tv+s+F+a+++l++ ++++++Al++iS  ++ L+++i+ qi
  Lj0g3v0086419.1 334 QAAESIKSQLLMLLQLVDNRYSQCLDEVHTVVSAFHAATELDP-HIHAHFALQTISLLYKDLRERISTQI 402
                      6778889************************************.************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-18265400IPR006563POX domain
PfamPF075262.0E-24271399IPR006563POX domain
PROSITE profilePS5007111.208440503IPR001356Homeobox domain
CDDcd000864.55E-11443504No hitNo description
SMARTSM003895.3E-6443507IPR001356Homeobox domain
SuperFamilySSF466891.41E-15445512IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-26446509IPR009057Homeodomain-like
PfamPF059204.9E-15460499IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MENAMFSDPL DMADQNSTCI EDNITQHLIP KPLIYCCSFD LNSQSHIING IPILSGEQTE  60
HISNAQLDGS FINPVTIANS NSFATSQGMT FMLDASNPTG NSDFEDHLAG GRPISCASVP  120
ARIGLQENLE NSASLEVSGP FVFNNWQDSS NPLSANFCSS GYDEAPSNGR WIFNKFLKAS  180
EADLTGLLPY SSIGNIEPNG WSSSNVANLA NHAYNSSNCS NELSLSLASS SPTTGQCSDL  240
THSMNGTSSG NSMEVSMSMD SNGRFQFSPA ILGSRYLSGI QEILVQIATY SFENLEEVNY  300
SAAGVRGGNK STSAFTPKRR IATNHNADSP LQGQAAESIK SQLLMLLQLV DNRYSQCLDE  360
VHTVVSAFHA ATELDPHIHA HFALQTISLL YKDLRERIST QILAMGSNFN MSCSEEEKEW  420
SMETSFVQKQ WALQQLKRKD QLWRPQRGLP ERSVSVLRAW MFQNFLHPYP KEAEKHLLAV  480
KSGLTRSQVS NWFINARVRL WKPMIEEMYA EMSRRKACRN EEGKETSHKS RISLNNQMFN  540
IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-15449507563Homeobox protein Meis2
3k2a_B3e-15449507563Homeobox protein Meis2
4xrs_A3e-15449506158Homeobox protein Meis1
4xrs_B3e-15449506158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160994.10.0hypothetical protein PHAVU_001G034200g
SwissprotP487311e-100ATH1_ARATH; Homeobox protein ATH1
TrEMBLV7CUC50.0V7CUC5_PHAVU; Uncharacterized protein
STRINGGLYMA17G34811.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-98homeobox gene 1