PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0058429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WRKY
Protein Properties Length: 328aa    MW: 37454.9 Da    PI: 6.8235
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0058429.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054e-33164221259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v +tYeg+Hnh+
  Lj0g3v0058429.1 164 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSFQDPSIVMTTYEGQHNHH 221
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-34148223IPR003657WRKY domain
SuperFamilySSF1182905.62E-29156223IPR003657WRKY domain
PROSITE profilePS5081131.743158223IPR003657WRKY domain
SMARTSM007741.2E-38163222IPR003657WRKY domain
PfamPF031061.1E-25164221IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MANNEKDRYD DHPFYHHNHH EHHELNHLPS SFPSQNFQGF DPSHATFNDY LHGSMDYNTL  60
SRAFDLSCSS PEVISSSIDE NSKKPSVGDS VGMPTPNSSV SCSSNEAEPV AEEDSTKSKK  120
DKEPKGCEDE DEGSKKENNP KKKEKKAREP RFAFLTKSEI DHLEDGYRWR KYGQKAVKNS  180
PYPRSYYRCT TQKCTVKKRV ERSFQDPSIV MTTYEGQHNH HCPATLRGNA VSMFSSPSLF  240
GSSTSMGSLG STLPQNFYAQ LLPSYSQGHD GHHENPTFHQ NDHFNRHSQP QRQPELQLQQ  300
NQQLQFQHPH DYGLLQDLLP SFPGKQEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-281562241078Probable WRKY transcription factor 4
2lex_A1e-281562241078Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.201650.0pod
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0058429.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4244942e-53CU424494.2 Medicago truncatula chromosome 5 clone mth2-103o8, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027332031.11e-130WRKY transcription factor 71-like
SwissprotQ8VWJ21e-63WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A371FK601e-123A0A371FK60_MUCPR; Putative WRKY transcription factor 28
STRINGGLYMA14G03280.11e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.15e-49WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]