PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0057839.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 627aa    MW: 69767.6 Da    PI: 6.208
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0057839.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093774141954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   n+yp+ +e+  LA+++gL+ +qV +WF N R +
  Lj0g3v0057839.2 377 FEHflNPYPKDSEKIMLARQTGLSRNQVANWFINARVR 414
                      665569******************************88 PP

2BELL124.15.4e-40248319172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erq l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++v g+g+a+pYt+lAl++iSrhFrcL+dai++qi
  Lj0g3v0057839.2 248 ERQHLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVSGCGAAEPYTALALRTISRHFRCLRDAISGQI 319
                      6889999****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.5E-54166317IPR006563POX domain
PfamPF075262.2E-49173316IPR006563POX domain
PROSITE profilePS5007112.746355418IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-27357431IPR009057Homeodomain-like
SMARTSM003892.0E-9358422IPR001356Homeobox domain
CDDcd000861.37E-12358419No hitNo description
SuperFamilySSF466891.58E-17359425IPR009057Homeodomain-like
PfamPF059201.6E-17375414IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MYPNQAFSSG SYAEMLSGSS MLPHNYSESV GGQNELKFMA SMGDNMTIQP MEEHSNAGAG  60
DSHVISRTQL GLVDIEQQNV QGQGLSLSLG TVMQSVPSFQ YQYPGSGFTS LMSSQIPNLK  120
GTEDEANLHK ELRNAECMTP VSSGGFHKRE DFYNPHQSDP YLHGAAGFSA NNVMNSQYLK  180
VAQELLDEIV NVRKPLKPTG LEKQQSFRDI GLDGSKDSDG KSTSQSMQMS SGPNGSTANS  240
SCELSPAERQ HLLDKKTKLL SMLDEVDKRY RQYCHQMQIV VSSFDMVSGC GAAEPYTALA  300
LRTISRHFRC LRDAISGQIQ VTQRSLGEQE GIPRLRNVDQ KLRQQKALQQ LGVMRQAWRP  360
QRGLPENSVS ILRAWLFEHF LNPYPKDSEK IMLARQTGLS RNQVANWFIN ARVRLWKPMV  420
EEMYKEEFGD SEMSSSNLLS ENTPKASRED VQVSGNKREE SQDKLTTIDS LQQQGQIHGL  480
KLDHASSTAE LDRGIQSGDD HGTNVMDFRT GKLHGDQRFN MNNSPYSSAP MQITHNGDGC  540
IMASTPATYD LADLGNFSTV GGHVSLALEL RNSENNGFGV SNDDTYKRHD QTLASSQEND  600
MLEYHFTDSG KQQHKFGNPH LLHEFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A9e-15364421158Homeobox protein Meis1
4xrs_B9e-15364421158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.259050.0pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1369900.0BT136990.1 Lotus japonicus clone JCVI-FLLj-16H21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589334.10.0BEL1-related homeotic protein
SwissprotQ9FWS91e-111BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLG7I5U50.0G7I5U5_MEDTR; BEL1-related homeotic protein
STRINGGLYMA14G07710.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-101BEL1-like homeodomain 7