PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0050029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family ARR-B
Protein Properties Length: 583aa    MW: 65393.1 Da    PI: 5.063
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0050029.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.73e-24200253155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Lj0g3v0050029.1 200 KARVVWSVDLHQKFVRAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 253
                      68*******************.9*******************************8 PP

2Response_reg80.84.5e-27201281109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+p+ +++l+++l+k +y +v+++  ++ al ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ 
  Lj0g3v0050029.1  20 VLVVDDDPTWLKILEKMLKKCNY-DVTTCCLARHALSLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQH 111
                      89*********************.***************999999**********************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ ++el++
  Lj0g3v0050029.1 112 GACDYLLKPIRMKELRN 128
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.9E-1462556IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.8E-4417160No hitNo description
SuperFamilySSF521721.27E-3517145IPR011006CheY-like superfamily
SMARTSM004483.3E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.62919134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2420129IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.54E-2921134No hitNo description
SuperFamilySSF466893.23E-17198257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-28198258IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-21200253IPR006447Myb domain, plants
PfamPF002492.4E-7202252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MENGCFPSPP RRDFPAGLRV LVVDDDPTWL KILEKMLKKC NYDVTTCCLA RHALSLLRER  60
KDGYDIVISD VNMPDMDGFK LLEHVGLEMD LPVIMMSVDG ETSRVMKGVQ HGACDYLLKP  120
IRMKELRNIW QHVLRKRIHE AREFESFESF EGNYLMRNGS ELSDDGNLFA LEDMTSSKKR  180
KDADNKHDDK EFVDPSSTKK ARVVWSVDLH QKFVRAVNQI GFDKVGPKKI LDLMNVPWLT  240
RENVASHLQK YRLYLSRLQK DDEQKSSSSG MKISDLPTKE VGSFGLHNSV TKQQNDVSID  300
SCNYPDGALQ IQKVETKSQE GNTKGIVSQS TMEEKGRALT GNNNITDVMR EGLQVGLNQP  360
FALPESKGNC TSFDCAIPTK YSWTEVPGMQ LKEEQKSIVQ LEDSFNQLPP LLGKQHHIQV  420
DQSQSIASIS STPSIMKEDV PACIETKPVF SDYKSSYTSS ISSKVSALDT FPIQPGSLMM  480
SDQPLQPTSA ANLGLKTQGS NLSSISDLEF YQRNLLLGGD APSASLDEDL YSYWIQGECY  540
NMNFGLQSVA MPEFYDPGLI AEVPPHLYDS TDYTVIDQGL FIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17196258163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0050029.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028213070.10.0two-component response regulator ARR11-like isoform X1
TrEMBLA0A0B2QVM40.0A0A0B2QVM4_GLYSO; Two-component response regulator ARR11
STRINGAES721000.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-119response regulator 11