PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1449s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family VOZ
Protein Properties Length: 495aa    MW: 55425.2 Da    PI: 6.2708
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1449s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ433.92.3e-1332214371217
                  VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          pppsaflgpkcalwdc+rpaqg +w+qdycssfha+la+neg+pg+tpvlrp+gi+lkd+llfaal akv+gk+vgipecegaat+kspw
  Kalax.1449s0006.1.p 221 PPPSAFLGPKCALWDCPRPAQGPDWCQDYCSSFHAALAFNEGPPGMTPVLRPNGIGLKDSLLFAALAAKVHGKDVGIPECEGAATTKSPW 310
                          89**************************************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          na+elfdls+legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++efgglkrsyymdpqp++++ewhlyeyei+++d +
  Kalax.1449s0006.1.p 311 NAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINEFGGLKRSYYMDPQPLKHYEWHLYEYEISKCDIC 400
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrlelkl+d+kk +kgk  +dsladlqk++grlta
  Kalax.1449s0006.1.p 401 ALYRLELKLADGKKIPKGKTPSDSLADLQKQMGRLTA 437
                          ***********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MERPHERVYF RGFVGKLGIL PMGKGSRSNC KSTSHRMFRD KAKNKVDDLQ GIFADLQYAR  60
KESRTTDAAL LEEQVHQMLR EWRSELNEPS PATSLQGGSL GSFSSDICRL LQLYEEEEDD  120
ATSRLAAPKT EPDAAHSVQA QDVAIEQVTL TNQLPQEHSY QLGNNCKSSM AEMHNMGHNN  180
LGGVESREFQ LHQDFEKSFY ALPEEDVNVM PNADFLPNIC PPPSAFLGPK CALWDCPRPA  240
QGPDWCQDYC SSFHAALAFN EGPPGMTPVL RPNGIGLKDS LLFAALAAKV HGKDVGIPEC  300
EGAATTKSPW NAPELFDLSV LEGETIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES  360
RKQVINEFGG LKRSYYMDPQ PLKHYEWHLY EYEISKCDIC ALYRLELKLA DGKKIPKGKT  420
PSDSLADLQK QMGRLTAEFP SDHKFSAKGR IKIYPKDSHG HFATNQAAHA SDSGAGNGSA  480
PYYLVDNLDE YFLT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273268.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLF6HM510.0F6HM51_VITVI; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]