PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1312s0003.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family VOZ
Protein Properties Length: 488aa    MW: 53804 Da    PI: 5.1536
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1312s0003.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ395.41.3e-1212114251217
                  VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          ppp+aflg kcalwdc+rp q ++  qdyc+ +ha lalneg+ gt+pvlrp+gi+lkd+ lf+al+ak+qgkevgip+c+ga++a+spw
  Kalax.1312s0003.5.p 211 PPPAAFLGSKCALWDCPRPPQTFD--QDYCNDIHARLALNEGAAGTSPVLRPGGISLKDSILFDALKAKIQGKEVGIPQCDGAVSARSPW 298
                          89*******************998..7*************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          na+elfdlslleget+rewlffdkpr+afesgnrkqrslpdysgrgwhesrkqv+ke gglkrsyymdpqp s++ewhlyey i+++da 
  Kalax.1312s0003.5.p 299 NAPELFDLSLLEGETLREWLFFDKPRKAFESGNRKQRSLPDYSGRGWHESRKQVVKESGGLKRSYYMDPQPVSHLEWHLYEYGIDKCDAQ 388
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrlelklvd+kk +kgkvskd++adlq ++g+lta
  Kalax.1312s0003.5.p 389 ALYRLELKLVDGKKKSKGKVSKDPVADLQTQMGKLTA 425
                          ***********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MQKDSKHKCN SASHKQLKSN AKNRLDELQD MFSSLQYARK EGQNNTVCEL EDQVNQMLKN  60
WKTELNETSS TSSLHGPGSS LGLDSADIRR LLLLSDEEDD ATSPLDESKA GQHSCGGQAL  120
HDGDGSFLFQ NNPSTNYILQ ERGFEGSNYV WPSMHDPNLK RNSQAQYHPF ELQPSAGGEF  180
IISSDNLDQN LLPAENVLHD FTGFLPAIVQ PPPAAFLGSK CALWDCPRPP QTFDQDYCND  240
IHARLALNEG AAGTSPVLRP GGISLKDSIL FDALKAKIQG KEVGIPQCDG AVSARSPWNA  300
PELFDLSLLE GETLREWLFF DKPRKAFESG NRKQRSLPDY SGRGWHESRK QVVKESGGLK  360
RSYYMDPQPV SHLEWHLYEY GIDKCDAQAL YRLELKLVDG KKKSKGKVSK DPVADLQTQM  420
GKLTADLPTE SKFPKMSLSE TGEAGDECSP STPFAPDQLT STAGSVDTGI SGVSDDYVNI  480
LTDCKRI*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023908455.11e-169transcription factor VOZ1
SwissprotQ9SGQ01e-158VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1R3I1631e-166A0A1R3I163_COCAP; Uncharacterized protein
STRINGXP_010111154.11e-166(Morus notabilis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-112vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]