PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0684s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 110aa    MW: 11662.8 Da    PI: 8.2355
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0684s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.11e-283690358
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                         ++rY eC++N+A+ +Gg avDGC+Efm++ g+egta+al CaAC CHR+FHRr + 
  Kalax.0684s0003.1.p 36 SIRYMECQRNQAVVVGGFAVDGCREFMAT-GQEGTAEALICAACTCHRSFHRRVEI 90
                         689*************************8.999********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-163587IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.8E-273789IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.1E-233887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.0783988IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MSGRRADQGR SNGAHQGFNN GSVSNAANNM PVSSTSIRYM ECQRNQAVVV GGFAVDGCRE  60
FMATGQEGTA EALICAACTC HRSFHRRVEI HQAVNLTHSA ATNSQQNGY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408377.14e-24PREDICTED: mini zinc finger protein 1-like
TrEMBLA0A059A5787e-24A0A059A578_EUCGR; Uncharacterized protein
STRINGVIT_14s0108g00760.t019e-22(Vitis vinifera)
STRINGSb08g001830.18e-22(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-23mini zinc finger 1