PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0481s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 288aa    MW: 31569.1 Da    PI: 7.2872
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0481s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.13.3e-3175129358
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          + rY+eClkNhA+s+ ghavDGCgEfmp  g +g+ aalkCaACgCHRnFHR+e++
  Kalax.0481s0019.1.p  75 RPRYRECLKNHAVSVMGHAVDGCGEFMPG-GPDGSLAALKCAACGCHRNFHRKEEV 129
                          579*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015668.6E-2877127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-2877128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.5478127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-1978127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.93E-15184258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28187257IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-23197253IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEFDDHHHRE DEEEEEEEAS DEMMMGNDRN ISGDVGGGEV GNSLSRVRMA EAFSQVQIQP  60
TPTMIVPPPP PLAARPRYRE CLKNHAVSVM GHAVDGCGEF MPGGPDGSLA ALKCAACGCH  120
RNFHRKEEVP VVYTHTPHLT HHQTPPGAFA SYYSTTPSGY LQLGAPRART LALPPSSGGN  180
DDASNPNGGG RASSDGKKRF RTKFTAEQKQ QMLAMAERIG WRIQRGVEEL VQQFCHEAAV  240
KRHVFKVWMH NNKHTLGRIS STNPNTTTTN NNHSNGGASN RQHQLMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-221972551775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.12e-71PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ9SB612e-60ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A0L9UB564e-69A0A0L9UB56_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3364e-69A0A0S3T336_PHAAN; Uncharacterized protein
TrEMBLK7K6C79e-69K7K6C7_SOYBN; Uncharacterized protein
STRINGGLYMA02G04550.23e-68(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-59homeobox protein 22