PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0476s0028.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 279aa    MW: 30885.1 Da    PI: 10.0671
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0476s0028.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly208.38.3e-651032411139
               Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkv 90 
                          s+yk+kaal+v+++ p+f  l+sg++k+ ++G++ll++a+a + r+ydW++kq+f+ls+ e+++l++l++kesceffhdp++++s+eGkv
  Kalax.0476s0028.2.p 103 SIYKGKAALTVEPRGPEFAPLESGSFKVAKDGFVLLQFAPASGLRQYDWSRKQVFSLSVVEIGTLMSLGPKESCEFFHDPFKGKSDEGKV 192
                          7***************************************************************************************** PP

               Whirly  91 rkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                          rk+lkvePl+dG+G+f+nlsv+n+l++ +es+++P++kaefa+l+s+++
  Kalax.0476s0028.2.p 193 RKVLKVEPLADGTGHFFNLSVQNKLLNMDESIYIPITKAEFAILNSVFN 241
                          *********************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.1E-7692260IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.67E-7396277IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.1E-60104239IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009570Cellular Componentchloroplast stroma
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MTSLQILPHS LQTRNPRLLP NSRFPLEGSV HRIARSSIIS RSPSSEIATK KSLKNQTSFI  60
LCRRSEYFEP QRFDSSRPSY DRPGGSGGGE GGDFQTRVFV GHSIYKGKAA LTVEPRGPEF  120
APLESGSFKV AKDGFVLLQF APASGLRQYD WSRKQVFSLS VVEIGTLMSL GPKESCEFFH  180
DPFKGKSDEG KVRKVLKVEP LADGTGHFFN LSVQNKLLNM DESIYIPITK AEFAILNSVF  240
NFILPHLIGW HAYATSIKPG GASRVNNTGS PVDYEWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_A2e-98962617172Single-stranded DNA-binding protein WHY1, chl
4koo_B2e-98962617172Single-stranded DNA-binding protein WHY1, chl
4koo_C2e-98962617172Single-stranded DNA-binding protein WHY1, chl
4koo_D2e-98962617172Single-stranded DNA-binding protein WHY1, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277278.11e-114PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-110WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLD7TND71e-114D7TND7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01720.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-110ssDNA-binding transcriptional regulator