PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0448s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 248aa    MW: 27845.4 Da    PI: 9.5612
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0448s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly117.97e-37101183183
               Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaak 83 
                          s+yk+kaal+v++++p+f+ +dsg+ k++++G++ l++a+a ++r+ydW++kq+f+ls+ ev+++++l++k+sceffhdp+++
  Kalax.0448s0033.1.p 101 SIYKGKAALTVEPRAPEFSLMDSGAYKISKDGFVYLQFAPASGVRQYDWSRKQVFSLSVFEVGSIISLGPKDSCEFFHDPFKG 183
                          7*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.4E-4091184IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.1E-5694244IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.2E-34102184IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.105.5E-13186231IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MAYLRVFAPQ FAFRNPRTTP QLHVSSYESI ASVNFAQPVR TRATSHSGRT KPYLECMQSE  60
YFEPQRFSSS RRSMERFRSD EDGGGGGNAP SPSARVYVGY SIYKGKAALT VEPRAPEFSL  120
MDSGAYKISK DGFVYLQFAP ASGVRQYDWS RKQVFSLSVF EVGSIISLGP KDSCEFFHDP  180
FKGRRLLNVD ESIYIPINKA EFTVLVSAMR FILPYLLGWN AFANSIKPED SLRGNNANAS  240
VDFEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A4e-739524637219p24: plant transcriptional regulator PBF-2
1l3a_B4e-739524637219p24: plant transcriptional regulator PBF-2
1l3a_C4e-739524637219p24: plant transcriptional regulator PBF-2
1l3a_D4e-739524637219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In the nucleus, is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:19669906}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021664941.13e-87single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotQ66GR61e-81WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
TrEMBLA0A2C9WM721e-83A0A2C9WM72_MANES; Uncharacterized protein
STRINGcassava4.1_013407m2e-84(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-80ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Lepage É,Zampini É,Brisson N
    Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis.
    Plant Physiol., 2013. 163(2): p. 867-81
    [PMID:23969600]
  2. Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N
    Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans.
    Genome Res., 2015. 25(5): p. 645-54
    [PMID:25800675]
  3. Karpinska B,Alomrani SO,Foyer CH
    Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling.
    Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018.
    [PMID:28808105]