PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0424s0025.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 277aa    MW: 30384.7 Da    PI: 10.1657
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0424s0025.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly193.92.3e-601022392139
               Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                          v+k+kaal+v +v+ptf +ldsg l+l+r+G ++l++ +a++erkydWek+qsfalsatev++l+ l++++sceffhdp++k+sn+G+vr
  Kalax.0424s0025.1.p 102 VFKGKAALSVSPVLPTFRKLDSGGLQLDRRGVMMLKFWPAIGERKYDWEKRQSFALSATEVGSLLTLGPQDSCEFFHDPSMKTSNAGQVR 191
                          9***************************************************************************************** PP

               Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                          k+l+++  +d sG+f++lsv n+++k+ e+++vP++ aefav+r++++
  Kalax.0424s0025.1.p 192 KSLSIKANADNSGYFFSLSVANNILKTSERLTVPITSAEFAVIRTAFN 239
                          *********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.7E-7489254IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.45E-6494258IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.4E-60102236IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAQRLKFIGA LRSKHLFAAS SPTFSIMSHQ FYGNSSEAHQ SRQFLSNEMK LRAPGVMGCS  60
SKSSFTGNSC LYSSLMTCRS LYAQAAASSD NPSSKVYAPY TVFKGKAALS VSPVLPTFRK  120
LDSGGLQLDR RGVMMLKFWP AIGERKYDWE KRQSFALSAT EVGSLLTLGP QDSCEFFHDP  180
SMKTSNAGQV RKSLSIKANA DNSGYFFSLS VANNILKTSE RLTVPITSAE FAVIRTAFNF  240
ALPHIMGWDR IAYQLSAGVS YSTKAAPLVK DIEWDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A7e-899525110166StWhy2
3n1i_A7e-899525110166protein StWhy2
3n1j_A7e-899525110166Protein StWhy2
3n1k_A7e-899525110166protein StWhy2
3n1l_A7e-899525110166protein StWhy2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772795.13e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4
RefseqXP_016511179.13e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X5
RefseqXP_016511182.13e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X7
SwissprotD9J0345e-94WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLK4D8E02e-92K4D8E0_SOLLC; Uncharacterized protein
STRINGSolyc11g044750.1.17e-92(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-86WHIRLY 2