PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0302s0022.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 264aa    MW: 29761.5 Da    PI: 8.8476
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0302s0022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.91.8e-313086259
          ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                         ++vrY+eClkNhAas+G+++vDGCgEfmp  g+egt +alkCaAC CHRnFHRre e 
  Kalax.0302s0022.1.p 30 SGVRYRECLKNHAASMGTNVVDGCGEFMPG-GKEGTLEALKCAACHCHRNFHRRELEG 86
                         579**************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-203286IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.0E-293284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-293383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8023483IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.2E-29153222IPR009057Homeodomain-like
SuperFamilySSF466893.52E-19154222IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-27161217IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MYGGGGGELE SPESLVGTRS KAVKSGSPSS GVRYRECLKN HAASMGTNVV DGCGEFMPGG  60
KEGTLEALKC AACHCHRNFH RRELEGHDSG SGNFARSVIV HPLHLPPPTQ ISFRHPHHHR  120
HRIVQPVAVA YGGGATESSS EDLVQVFDEM PQREIEPGSG RKRFRTKFTQ EQKDKMLGFA  180
ERLGWRLQRQ DDEMVAKFCN EVGIRRHVLK VWMHNNKSSF KKPPVDEDQH QQQPTHPQIQ  240
LHPQHHHLLH LHHQHQQKQQ ETL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-251622191875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102085.12e-70hypothetical protein L484_009028
SwissprotO647221e-62ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLW9S6C32e-70W9S6C3_9R
STRINGPOPTR_0005s12420.18e-65(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.14e-64homeobox protein 21