PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0130s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 327aa    MW: 36115.5 Da    PI: 9.5475
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0130s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer87.11.8e-274295358
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                         ++ +keClkNhAa lGgha+DGCgEfmp+  e   +  +kC ACgCHRnFHR+ ++
  Kalax.0130s0013.1.p 42 EMIFKECLKNHAAGLGGHALDGCGEFMPA--ERVGPGLMKCEACGCHRNFHRQATA 95
                         689*************************9..4456999**************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.6E-234393IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-94392IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.8184593IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-244592IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.0E-25191264IPR009057Homeodomain-like
SuperFamilySSF466891.52E-15192264IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-23203259IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MKPNQMLEIG PGPATNQQLV AQTVSYAYQP MSPPHAAEET TEMIFKECLK NHAAGLGGHA  60
LDGCGEFMPA ERVGPGLMKC EACGCHRNFH RQATAAKSHY REPPRSVVGV TPPHFSFMPR  120
RCSSSPSTST SPHLSQPRQL NPPPQPPPTA ARYLHHHSFG AHMLMPLSTG KSASPPPPST  180
APIKISDHHQ TRRQQNPNPS TRRKRFRSKF SSEQKHRMRR FAEGLNWKIR KHDDMLVDRF  240
CADVGVSRAV LKVWMHNNKH TAGKNVPENP TDSSSGNNGE GEGAGRDEQL QLSNSEHRQQ  300
VDEGDDGLGL GVDLHQRHNH PLNQLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-212042621876ZF-HD homeobox family protein
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219QKHRMRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-25homeobox protein 31