PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0064s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 279aa    MW: 29639.1 Da    PI: 8.8888
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0064s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.83e-2954107357
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                          +  Y+eClkNhA+++ gha+DGC+Efm++ g eg+ +alkCaACgCHRnFHR+e+
  Kalax.0064s0071.1.p  54 RPIYRECLKNHAINVMGHALDGCCEFMAA-GPEGSLDALKCAACGCHRNFHRKEE 107
                          568*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.7E-2656107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2057106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.80257106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.8E-2557106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.55E-15181250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28182250IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-24189245IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MMNSSLNTNT NHNTVTSGGG GGGNNVSLSR ARMVEALSQV QIQPAPAVTA PSSRPIYREC  60
LKNHAINVMG HALDGCCEFM AAGPEGSLDA LKCAACGCHR NFHRKEEAVG GEPGAMLYSL  120
SHPHLAHPGP GGFGSYYPHP APPGYLHLAP PRPLALPSSS GGGAAGGSQD DDVSNPNAIV  180
AAGGSSNGKK RFRTKFTLEQ KEKMLAMAER IGWRIQRAEE ELVQQFCQEA AVKRHVFKVW  240
MHNNKHTLGR AGTTSNNHNN NNNNNNGGSS RQQQQLMD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A1e-251892521780ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519839.24e-74PREDICTED: zinc-finger homeodomain protein 1-like
RefseqXP_004143449.17e-75PREDICTED: zinc-finger homeodomain protein 1-like
RefseqXP_008440565.16e-75PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotA2Z2591e-65ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH58e-66ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0A0KGP38e-75A0A0A0KGP3_CUCSA; Zinc finger homeodomain protein 1
STRINGGLYMA02G04550.21e-73(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-61homeobox protein 22